Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P29122 (PCSK6_HUMAN)

Entry version 204 (10 Feb 2021)
Sequence version 1 (01 Dec 1992)
Previous versions | rss
Add a publicationFeedback
Protein

Proprotein convertase subtilisin/kexin type 6

Gene

PCSK6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues.

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei205Charge relay systemPROSITE-ProRule annotation1
Active sitei246Charge relay systemPROSITE-ProRule annotation1
Active sitei420Charge relay systemPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease
LigandCalcium

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.4.21.B25, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P29122

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1181150, Signaling by NODAL
R-HSA-167060, NGF processing
R-HSA-6809371, Formation of the cornified envelope
R-HSA-8963889, Assembly of active LPL and LIPC lipase complexes

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P29122

SIGNOR Signaling Network Open Resource

More...SIGNORi		P29122

Protein family/group databases

MEROPS protease database

More...MEROPSi		S08.075

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Proprotein convertase subtilisin/kexin type 6 (EC:3.4.21.-)
Alternative name(s):
Paired basic amino acid cleaving enzyme 4
Subtilisin-like proprotein convertase 4
Short name:
SPC4
Subtilisin/kexin-like protease PACE4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PCSK6
Synonyms:PACE4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8569, PCSK6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		167405, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P29122

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000140479.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		5046

Open Targets

More...OpenTargetsi		ENSG00000140479

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA32895

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P29122, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2951

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		2386

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PCSK6

Domain mapping of disease mutations (DMDM)

More...DMDMi		129542

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 63Sequence analysisAdd BLAST63
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002711064 – 1491 PublicationAdd BLAST86
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000027111150 – 969Proprotein convertase subtilisin/kexin type 6Add BLAST820

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi259N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi914N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi932N-linked (GlcNAc...) asparagineSequence analysis1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei149 – 150Cleavage; by autolysis1 Publication2

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Zymogen

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P29122

MaxQB - The MaxQuant DataBase

More...MaxQBi		P29122

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P29122

PeptideAtlas

More...PeptideAtlasi		P29122

PRoteomics IDEntifications database

More...PRIDEi		P29122

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54520 [P29122-1]
54521 [P29122-2]
54522 [P29122-3]
54523 [P29122-4]
54524 [P29122-5]
54525 [P29122-6]
54526 [P29122-7]
54527 [P29122-8]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P29122-3 [P29122-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P29122, 4 sites, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P29122

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P29122

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000140479, Expressed in C1 segment of cervical spinal cord and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P29122, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P29122, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000140479, Tissue enhanced (brain, liver, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The PACE4A-I precursor protein seems to exist in the reticulum endoplasmic as both a monomer and a dimer-sized complex whereas mature PACE4A-I exists only as a monomer, suggesting that propeptide cleavage affects its tertiary or quaternary structure.

Interacts (immature form including the propeptide) with RCN3; probably involved in the maturation and the secretion of PCSK6 (PubMed:16433634).

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111083, 11 interactors

Database of interacting proteins

More...DIPi		DIP-29903N

Protein interaction database and analysis system

More...IntActi		P29122, 11 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000482760

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P29122

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P29122, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P29122

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini168 – 487Peptidase S8PROSITE-ProRule annotationAdd BLAST320
Domaini495 – 635P/Homo BPROSITE-ProRule annotationAdd BLAST141
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati692 – 739FU 1Add BLAST48
Repeati743 – 790FU 2Add BLAST48
Repeati794 – 838FU 3Add BLAST45
Repeati842 – 887FU 4Add BLAST46
Repeati895 – 943FU 5Add BLAST49
Domaini931 – 969PLACPROSITE-ProRule annotationAdd BLAST39

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni695 – 930CRM (Cys-rich motif)Add BLAST236

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi553 – 555Cell attachment siteSequence analysis3

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum. Isoform PACE4D lacks the propeptide domain.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S8 family.Curated

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3525, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159506

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002976_4_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P29122

Database of Orthologous Groups

More...OrthoDBi		308083at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P29122

TreeFam database of animal gene trees

More...TreeFami		TF314277

Family and domain databases

Conserved Domains Database

More...CDDi		cd00064, FU, 4 hits
cd04059, Peptidases_S8_Protein_convertases_Kexins_Furin-like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.120.260, 1 hit
3.30.70.850, 1 hit
3.40.50.200, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000742, EGF-like_dom
IPR006212, Furin_repeat
IPR008979, Galactose-bd-like_sf
IPR032778, GF_recep_IV
IPR009030, Growth_fac_rcpt_cys_sf
IPR034182, Kexin/furin
IPR002884, P_dom
IPR000209, Peptidase_S8/S53_dom
IPR036852, Peptidase_S8/S53_dom_sf
IPR023827, Peptidase_S8_Asp-AS
IPR022398, Peptidase_S8_His-AS
IPR023828, Peptidase_S8_Ser-AS
IPR015500, Peptidase_S8_subtilisin-rel
IPR010909, PLAC
IPR032815, S8_pro-domain
IPR038466, S8_pro-domain_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF14843, GF_recep_IV, 1 hit
PF01483, P_proprotein, 1 hit
PF00082, Peptidase_S8, 1 hit
PF08686, PLAC, 1 hit
PF16470, S8_pro-domain, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00723, SUBTILISIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00181, EGF, 5 hits
SM00261, FU, 5 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49785, SSF49785, 1 hit
SSF52743, SSF52743, 1 hit
SSF57184, SSF57184, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51829, P_HOMO_B, 1 hit
PS50900, PLAC, 1 hit
PS51892, SUBTILASE, 1 hit
PS00136, SUBTILASE_ASP, 1 hit
PS00137, SUBTILASE_HIS, 1 hit
PS00138, SUBTILASE_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform PACE4A-I (identifier: P29122-1) [UniParc]FASTAAdd to basket
Also known as: PACE4

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPPRAPPAPG PRPPPRAAAA TDTAAGAGGA GGAGGAGGPG FRPLAPRPWR 
        60         70         80         90        100
WLLLLALPAA CSAPPPRPVY TNHWAVQVLG GPAEADRVAA AHGYLNLGQI 
       110        120        130        140        150
GNLEDYYHFY HSKTFKRSTL SSRGPHTFLR MDPQVKWLQQ QEVKRRVKRQ 
       160        170        180        190        200
VRSDPQALYF NDPIWSNMWY LHCGDKNSRC RSEMNVQAAW KRGYTGKNVV 
       210        220        230        240        250
VTILDDGIER NHPDLAPNYD SYASYDVNGN DYDPSPRYDA SNENKHGTRC 
       260        270        280        290        300
AGEVAASANN SYCIVGIAYN AKIGGIRMLD GDVTDVVEAK SLGIRPNYID 
       310        320        330        340        350
IYSASWGPDD DGKTVDGPGR LAKQAFEYGI KKGRQGLGSI FVWASGNGGR 
       360        370        380        390        400
EGDYCSCDGY TNSIYTISVS SATENGYKPW YLEECASTLA TTYSSGAFYE 
       410        420        430        440        450
RKIVTTDLRQ RCTDGHTGTS VSAPMVAGII ALALEANSQL TWRDVQHLLV 
       460        470        480        490        500
KTSRPAHLKA SDWKVNGAGH KVSHFYGFGL VDAEALVVEA KKWTAVPSQH 
       510        520        530        540        550
MCVAASDKRP RSIPLVQVLR TTALTSACAE HSDQRVVYLE HVVVRTSISH 
       560        570        580        590        600
PRRGDLQIYL VSPSGTKSQL LAKRLLDLSN EGFTNWEFMT VHCWGEKAEG 
       610        620        630        640        650
QWTLEIQDLP SQVRNPEKQG KLKEWSLILY GTAEHPYHTF SAHQSRSRML 
       660        670        680        690        700
ELSAPELEPP KAALSPSQVE VPEDEEDYTA QSTPGSANIL QTSVCHPECG 
       710        720        730        740        750
DKGCDGPNAD QCLNCVHFSL GSVKTSRKCV SVCPLGYFGD TAARRCRRCH 
       760        770        780        790        800
KGCETCSSRA ATQCLSCRRG FYHHQEMNTC VTLCPAGFYA DESQKNCLKC 
       810        820        830        840        850
HPSCKKCVDE PEKCTVCKEG FSLARGSCIP DCEPGTYFDS ELIRCGECHH 
       860        870        880        890        900
TCGTCVGPGR EECIHCAKNF HFHDWKCVPA CGEGFYPEEM PGLPHKVCRR 
       910        920        930        940        950
CDENCLSCAG SSRNCSRCKT GFTQLGTSCI TNHTCSNADE TFCEMVKSNR 
       960 
LCERKLFIQF CCRTCLLAG
Length:969
Mass (Da):106,420
Last modified:December 1, 1992 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA3599CC278D09B05
GO
Isoform PACE4A-II (identifier: P29122-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     680-693: AQSTPGSANILQTS → G

Show »
Length:956
Mass (Da):105,121
Checksum:iBA240E3EEBCC862F
GO
Isoform PACE4B (identifier: P29122-3) [UniParc]FASTAAdd to basket
Also known as: PACE4.1

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KGAAVAFWWTIGWPWNV
     472-969: Missing.

Note: Probably enzymatically inactive.Curated
Show »
Length:487
Mass (Da):53,044
Checksum:i10DB376359A7F1AF
GO
Isoform PACE4C (identifier: P29122-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-652: KLKEWSLILYGTAEHPYHTFSAHQSRSRMLEL → DLETPVANQLTTEEREPGLKHVFRWQIEQELW
     653-969: Missing.

Note: Probably enzymatically inactive.Curated
Show »
Length:652
Mass (Da):71,771
Checksum:i880D99278881942C
GO
Isoform PACE4CS (identifier: P29122-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-623: KLK → NLD
     624-969: Missing.

Note: Probably enzymatically inactive.Curated
Show »
Length:623
Mass (Da):68,238
Checksum:i19BCB5350278C621
GO
Isoform PACE4D (identifier: P29122-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-167: Missing.
     621-664: KLKEWSLILY...PELEPPKAAL → DLETPVANQL...YHIVLITVAL
     665-969: Missing.

Note: Probably enzymatically inactive.Curated
Show »
Length:497
Mass (Da):54,900
Checksum:i46C1F64CAEA0E3EB
GO
Isoform PACE4E-I (identifier: P29122-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG

Show »
Length:975
Mass (Da):106,674
Checksum:i31983E526116A67C
GO
Isoform PACE4E-II (identifier: P29122-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     680-693: AQSTPGSANILQTS → G
     901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG

Show »
Length:962
Mass (Da):105,375
Checksum:iF16ABF9230DE5F01
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WY68A0A087WY68_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
975Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BXT3H7BXT3_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
664Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WZR0A0A087WZR0_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
962Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y3Q0H0Y3Q0_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
797Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YMW5H0YMW5_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKZ4H0YKZ4_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
345Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLC8H0YLC8_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X025A0A087X025_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YW51A0A0J9YW51_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
308Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKK2H0YKK2_HUMAN
Proprotein convertase subtilisin/ke...
PCSK6
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti639T → I in BAA21624 (PubMed:9378725).Curated1
Sequence conflicti639T → I in BAA21625 (PubMed:9378725).Curated1
Sequence conflicti639T → I in BAA21626 (PubMed:9378725).Curated1
Sequence conflicti639T → I in BAA21627 (PubMed:9378725).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051824502C → R. Corresponds to variant dbSNP:rs1058260Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0054271 – 167Missing in isoform PACE4D. 1 PublicationAdd BLAST167
Alternative sequenceiVSP_005428471K → KGAAVAFWWTIGWPWNV in isoform PACE4B. 1 Publication1
Alternative sequenceiVSP_005429472 – 969Missing in isoform PACE4B. 1 PublicationAdd BLAST498
Alternative sequenceiVSP_005434621 – 664KLKEW…PKAAL → DLETPVANQLTTEERFVSTP SILFHWSVYLSWSQYHIVLI TVAL in isoform PACE4D. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_005432621 – 652KLKEW…RMLEL → DLETPVANQLTTEEREPGLK HVFRWQIEQELW in isoform PACE4C. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_005430621 – 623KLK → NLD in isoform PACE4CS. Curated3
Alternative sequenceiVSP_005431624 – 969Missing in isoform PACE4CS. CuratedAdd BLAST346
Alternative sequenceiVSP_005433653 – 969Missing in isoform PACE4C. 1 PublicationAdd BLAST317
Alternative sequenceiVSP_005435665 – 969Missing in isoform PACE4D. 1 PublicationAdd BLAST305
Alternative sequenceiVSP_005436680 – 693AQSTP…ILQTS → G in isoform PACE4A-II and isoform PACE4E-II. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_005437901 – 969CDENC…CLLAG → YGPPGGERQATVSSKGVPGG QSLSASSPGAGEGMLHHPTV DRSPFTELLRGLRPFVHWMH ICWVPAVGRHRAAAG in isoform PACE4E-I and isoform PACE4E-II. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M80482 mRNA Translation: AAA59998.1
AB001914 Genomic DNA Translation: BAA21620.1
AB001914 Genomic DNA Translation: BAA21621.1
AB001914 Genomic DNA Translation: BAA21622.1
AB001914 Genomic DNA Translation: BAA21623.1
AB001914 Genomic DNA Translation: BAA21624.1
AB001914 Genomic DNA Translation: BAA21625.1
AB001914 Genomic DNA Translation: BAA21626.1
AB001914 Genomic DNA Translation: BAA21627.1
D28513 mRNA Translation: BAA05871.1
D28514 mRNA Translation: BAA05872.1
D87995 mRNA Translation: BAA21793.1
D87993 mRNA Translation: BAA21791.1
D87994 mRNA Translation: BAA21792.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS73789.1 [P29122-2]
CCDS73790.1 [P29122-1]
CCDS73791.1 [P29122-5]
CCDS73793.1 [P29122-4]

Protein sequence database of the Protein Information Resource

More...PIRi		A39490
B39490
JC2191
JC2192
JC5570
JC5571

NCBI Reference Sequences

More...RefSeqi		NP_001278238.1, NM_001291309.1
NP_002561.1, NM_002570.4 [P29122-1]
NP_612192.1, NM_138319.3 [P29122-2]
NP_612195.1, NM_138322.3 [P29122-3]
NP_612196.1, NM_138323.2 [P29122-5]
NP_612197.1, NM_138324.2 [P29122-4]
NP_612198.2, NM_138325.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000611716; ENSP00000482760; ENSG00000140479 [P29122-1]
ENST00000611967; ENSP00000477768; ENSG00000140479 [P29122-4]
ENST00000615296; ENSP00000478081; ENSG00000140479 [P29122-5]
ENST00000618548; ENSP00000479496; ENSG00000140479 [P29122-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5046

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5046

UCSC genome browser

More...UCSCi		uc032csi.2, human [P29122-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80482 mRNA Translation: AAA59998.1
AB001914 Genomic DNA Translation: BAA21620.1
AB001914 Genomic DNA Translation: BAA21621.1
AB001914 Genomic DNA Translation: BAA21622.1
AB001914 Genomic DNA Translation: BAA21623.1
AB001914 Genomic DNA Translation: BAA21624.1
AB001914 Genomic DNA Translation: BAA21625.1
AB001914 Genomic DNA Translation: BAA21626.1
AB001914 Genomic DNA Translation: BAA21627.1
D28513 mRNA Translation: BAA05871.1
D28514 mRNA Translation: BAA05872.1
D87995 mRNA Translation: BAA21793.1
D87993 mRNA Translation: BAA21791.1
D87994 mRNA Translation: BAA21792.1
CCDSiCCDS73789.1 [P29122-2]
CCDS73790.1 [P29122-1]
CCDS73791.1 [P29122-5]
CCDS73793.1 [P29122-4]
PIRiA39490
B39490
JC2191
JC2192
JC5570
JC5571
RefSeqiNP_001278238.1, NM_001291309.1
NP_002561.1, NM_002570.4 [P29122-1]
NP_612192.1, NM_138319.3 [P29122-2]
NP_612195.1, NM_138322.3 [P29122-3]
NP_612196.1, NM_138323.2 [P29122-5]
NP_612197.1, NM_138324.2 [P29122-4]
NP_612198.2, NM_138325.3

3D structure databases

SMRiP29122
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi111083, 11 interactors
DIPiDIP-29903N
IntActiP29122, 11 interactors
STRINGi9606.ENSP00000482760

Chemistry databases

BindingDBiP29122
ChEMBLiCHEMBL2951
GuidetoPHARMACOLOGYi2386

Protein family/group databases

MEROPSiS08.075

PTM databases

GlyGeniP29122, 4 sites, 1 O-linked glycan (1 site)
iPTMnetiP29122
PhosphoSitePlusiP29122

Genetic variation databases

BioMutaiPCSK6
DMDMi129542

Proteomic databases

MassIVEiP29122
MaxQBiP29122
PaxDbiP29122
PeptideAtlasiP29122
PRIDEiP29122
ProteomicsDBi54520 [P29122-1]
54521 [P29122-2]
54522 [P29122-3]
54523 [P29122-4]
54524 [P29122-5]
54525 [P29122-6]
54526 [P29122-7]
54527 [P29122-8]
TopDownProteomicsiP29122-3 [P29122-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1024, 310 antibodies

Genome annotation databases

EnsembliENST00000611716; ENSP00000482760; ENSG00000140479 [P29122-1]
ENST00000611967; ENSP00000477768; ENSG00000140479 [P29122-4]
ENST00000615296; ENSP00000478081; ENSG00000140479 [P29122-5]
ENST00000618548; ENSP00000479496; ENSG00000140479 [P29122-2]
GeneIDi5046
KEGGihsa:5046
UCSCiuc032csi.2, human [P29122-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5046
DisGeNETi5046

GeneCards: human genes, protein and diseases

More...GeneCardsi		PCSK6
HGNCiHGNC:8569, PCSK6
HPAiENSG00000140479, Tissue enhanced (brain, liver, lymphoid tissue)
MIMi167405, gene
neXtProtiNX_P29122
OpenTargetsiENSG00000140479
PharmGKBiPA32895
VEuPathDBiHostDB:ENSG00000140479.16

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3525, Eukaryota
GeneTreeiENSGT00940000159506
HOGENOMiCLU_002976_4_1_1
InParanoidiP29122
OrthoDBi308083at2759
PhylomeDBiP29122
TreeFamiTF314277

Enzyme and pathway databases

BRENDAi3.4.21.B25, 2681
PathwayCommonsiP29122
ReactomeiR-HSA-1181150, Signaling by NODAL
R-HSA-167060, NGF processing
R-HSA-6809371, Formation of the cornified envelope
R-HSA-8963889, Assembly of active LPL and LIPC lipase complexes
SignaLinkiP29122
SIGNORiP29122

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5046, 6 hits in 126 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PCSK6, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PCSK6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5046
PharosiP29122, Tchem

Protein Ontology

More...PROi		PR:P29122
RNActiP29122, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000140479, Expressed in C1 segment of cervical spinal cord and 212 other tissues
ExpressionAtlasiP29122, baseline and differential
GenevisibleiP29122, HS

Family and domain databases

CDDicd00064, FU, 4 hits
cd04059, Peptidases_S8_Protein_convertases_Kexins_Furin-like, 1 hit
Gene3Di2.60.120.260, 1 hit
3.30.70.850, 1 hit
3.40.50.200, 1 hit
InterProiView protein in InterPro
IPR000742, EGF-like_dom
IPR006212, Furin_repeat
IPR008979, Galactose-bd-like_sf
IPR032778, GF_recep_IV
IPR009030, Growth_fac_rcpt_cys_sf
IPR034182, Kexin/furin
IPR002884, P_dom
IPR000209, Peptidase_S8/S53_dom
IPR036852, Peptidase_S8/S53_dom_sf
IPR023827, Peptidase_S8_Asp-AS
IPR022398, Peptidase_S8_His-AS
IPR023828, Peptidase_S8_Ser-AS
IPR015500, Peptidase_S8_subtilisin-rel
IPR010909, PLAC
IPR032815, S8_pro-domain
IPR038466, S8_pro-domain_sf
PfamiView protein in Pfam
PF14843, GF_recep_IV, 1 hit
PF01483, P_proprotein, 1 hit
PF00082, Peptidase_S8, 1 hit
PF08686, PLAC, 1 hit
PF16470, S8_pro-domain, 1 hit
PRINTSiPR00723, SUBTILISIN
SMARTiView protein in SMART
SM00181, EGF, 5 hits
SM00261, FU, 5 hits
SUPFAMiSSF49785, SSF49785, 1 hit
SSF52743, SSF52743, 1 hit
SSF57184, SSF57184, 2 hits
PROSITEiView protein in PROSITE
PS51829, P_HOMO_B, 1 hit
PS50900, PLAC, 1 hit
PS51892, SUBTILASE, 1 hit
PS00136, SUBTILASE_ASP, 1 hit
PS00137, SUBTILASE_HIS, 1 hit
PS00138, SUBTILASE_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCSK6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P29122
Secondary accession number(s): Q15099
, Q15100, Q9UEG7, Q9UEJ1, Q9UEJ2, Q9UEJ7, Q9UEJ8, Q9UEJ9, Q9Y4G9, Q9Y4H0, Q9Y4H1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: December 1, 1992
Last modified: February 10, 2021
This is version 204 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again