UniProtKB - P29017 (CD1C_HUMAN)

BLAST

>sp|P29017|CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDS
ESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGC
ELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNL
IRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWM
RNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHF
SMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL

Align
Format
Add to basket Added to basket
History
Entry version 167 (07 Nov 2018)
Sequence version 2 (03 Apr 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

T-cell surface glycoprotein CD1c

Gene

CD1C

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.4 Publications

Miscellaneous

During protein synthesis and maturation, CD1 family members bind endogenous lipids that are replaced by lipid or glycolipid antigens when the proteins are internalized and pass through endosomes or lysosomes, before trafficking back to the cell surface.

GO - Molecular functionⁱ

endogenous lipid antigen binding
Source: UniProtKB
Inferred from direct assayⁱ
- 21167756
exogenous lipid antigen binding
Source: UniProtKB
Inferred from direct assayⁱ
- 21167756
glycolipid binding
Source: UniProtKB
Inferred from direct assayⁱ
- 21167756
lipopeptide binding
Source: UniProtKB
Inferred from direct assayⁱ
- 21167756

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

adaptive immune response Source: UniProtKB-KW
antigen processing and presentation, endogenous lipid antigen via MHC class Ib
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
antigen processing and presentation, exogenous lipid antigen via MHC class Ib
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
immune response
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
positive regulation of T cell mediated cytotoxicity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
regulation of immune response Source: Reactome
T cell activation involved in immune response
Source: UniProtKB
Inferred from direct assayⁱ
- 21167756

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Adaptive immunity, Immunity
Ligand	Lipid-binding

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: T-cell surface glycoprotein CD1c Alternative name(s): CD_antigen: CD1c
Gene namesⁱ	Name:CD1C
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000158481.12
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:1636 CD1C
MIMⁱ	188340 gene
neXtProtⁱ	NX_P29017

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	18 – 302	ExtracellularSequence analysisAdd BLAST	285
Transmembraneⁱ	303 – 323	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	324 – 333	CytoplasmicSequence analysis	10

Keywords - Cellular componentⁱ

Cell membrane, Endosome, Lysosome, Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	911
Open Targets More...OpenTargetsⁱ	ENSG00000158481
PharmGKBⁱ	PA26195

Polymorphism and mutation databases

BioMutaⁱ	CD1C
DMDMⁱ	143811371

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 17	Sequence analysisAdd BLAST		17
ChainⁱPRO_0000014580	18 – 333	T-cell surface glycoprotein CD1cAdd BLAST		316

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	38	N-linked (GlcNAc...) asparagine2 Publications	1
Glycosylationⁱ	70	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	75	N-linked (GlcNAc...) asparagine1 Publication	1
Disulfide bondⁱ	120 ↔ 185	PROSITE-ProRule annotation1 Publication
Glycosylationⁱ	146	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	225 ↔ 280	PROSITE-ProRule annotation

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P29017
PaxDbⁱ	P29017
PeptideAtlas More...PeptideAtlasⁱ	P29017
PRIDEⁱ	P29017
ProteomicsDBⁱ	54513

PTM databases

iPTMnetⁱ	P29017
PhosphoSitePlusⁱ	P29017
SwissPalmⁱ	P29017

Expressionⁱ

Tissue specificityⁱ

Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Gene expression databases

Bgeeⁱ	ENSG00000158481 Expressed in 138 organ(s), highest expression level in thymus
CleanExⁱ	HS_CD1C
ExpressionAtlasⁱ	P29017 baseline and differential
Genevisibleⁱ	P29017 HS

Interactionⁱ

Subunit structureⁱ

Protein-protein interaction databases

IntActⁱ	P29017, 2 interactors
STRINGⁱ	9606.ENSP00000357152

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	25 – 38	Combined sources	14
Beta strandⁱ	41 – 50	Combined sources	10
Beta strandⁱ	53 – 59	Combined sources	7
Turnⁱ	60 – 63	Combined sources	4
Beta strandⁱ	64 – 67	Combined sources	4
Turnⁱ	70 – 75	Combined sources	6
Helixⁱ	78 – 103	Combined sources	26
Helixⁱ	107 – 109	Combined sources	3
Beta strandⁱ	111 – 123	Combined sources	13
Beta strandⁱ	124 – 126	Combined sources	3
Beta strandⁱ	129 – 136	Combined sources	8
Beta strandⁱ	139 – 144	Combined sources	6
Beta strandⁱ	146 – 151	Combined sources	6
Beta strandⁱ	153 – 155	Combined sources	3
Helixⁱ	157 – 168	Combined sources	12
Helixⁱ	171 – 182	Combined sources	12
Helixⁱ	184 – 200	Combined sources	17
Beta strandⁱ	207 – 214	Combined sources	8
Beta strandⁱ	221 – 233	Combined sources	13
Beta strandⁱ	235 – 241	Combined sources	7
Beta strandⁱ	244 – 246	Combined sources	3
Beta strandⁱ	249 – 251	Combined sources	3
Beta strandⁱ	262 – 264	Combined sources	3
Beta strandⁱ	278 – 284	Combined sources	7
Helixⁱ	285 – 287	Combined sources	3
Beta strandⁱ	292 – 295	Combined sources	4

Show more details

3D structure databases

ProteinModelPortalⁱ	P29017
SMRⁱ	P29017
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P29017

EvolutionaryTraceⁱ

P29017

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	206 – 296	Ig-likeAdd BLAST		91

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	329 – 332	Internalization signal		4

Keywords - Domainⁱ

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410JACG Eukaryota ENOG41113WA LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00480000042665
HOGENOMⁱ	HOG000111666
HOVERGENⁱ	HBG004453
InParanoidⁱ	P29017
KEGG Orthology (KO) More...KOⁱ	K06448
OMAⁱ	ILYWGHH
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0H36
PhylomeDBⁱ	P29017
TreeFamⁱ	TF336723

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit 3.30.500.10, 1 hit
InterProⁱ	View protein in InterPro IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003597 Ig_C1-set IPR011161 MHC_I-like_Ag-recog IPR037055 MHC_I-like_Ag-recog_sf IPR011162 MHC_I/II-like_Ag-recog
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF07654 C1-set, 1 hit PF16497 MHC_I_3, 1 hit
SMARTⁱ	View protein in SMART SM00407 IGc1, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit SSF54452 SSF54452, 1 hit
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show all Align All

P29017-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLFLQFLLLA LLLPGGDNAD ASQEHVSFHV IQIFSFVNQS WARGQGSGWL 
        60         70         80         90        100
DELQTHGWDS ESGTIIFLHN WSKGNFSNEE LSDLELLFRF YLFGLTREIQ 
       110        120        130        140        150
DHASQDYSKY PFEVQVKAGC ELHSGKSPEG FFQVAFNGLD LLSFQNTTWV 
       160        170        180        190        200
PSPGCGSLAQ SVCHLLNHQY EGVTETVYNL IRSTCPRFLL GLLDAGKMYV 
       210        220        230        240        250
HRQVRPEAWL SSRPSLGSGQ LLLVCHASGF YPKPVWVTWM RNEQEQLGTK 
       260        270        280        290        300
HGDILPNADG TWYLQVILEV ASEEPAGLSC RVRHSSLGGQ DIILYWGHHF 
       310        320        330 
SMNWIALVVI VPLVILIVLV LWFKKHCSYQ DIL

Length:333

Mass (Da):37,654

Last modified:April 3, 2007 - v2

Checksum:ⁱ8E4E057097E3E440

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	H0Y6Y6	H0Y6Y6_HUMAN		T-cell surface glycoprotein CD1c T-cell surface glycoprotein CD1c	CD1C	281	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	290	Q → R in CAG33361 (Ref. 3) Curated		1
Sequence conflictⁱ	327 – 333	CSYQDIL → W in AAA51942 (PubMed:2447586).Curated		7

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_031564	70	N → T. Corresponds to variant dbSNP:rs3138100Ensembl.		1
Natural variantⁱVAR_031565	300	F → S1 PublicationCorresponds to variant dbSNP:rs3138105Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M22178 , M22174, M22175, M22176, M22177 Genomic DNA Translation: AAA51942.1 M28827 mRNA Translation: AAA51941.1 CR457080 mRNA Translation: CAG33361.1 AL121986 Genomic DNA No translation available. BC126465 mRNA Translation: AAI26466.1 BC126467 mRNA Translation: AAI26468.1 AF142667 Genomic DNA Translation: AAD37580.1 M14667 Genomic DNA Translation: AAA51938.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS1175.1
PIRⁱ	C45801 HLHUCC
NCBI Reference Sequences More...RefSeqⁱ	NP_001756.2, NM_001765.2
UniGeneⁱ	Hs.132448

Genome annotation databases

Ensemblⁱ	ENST00000368170; ENSP00000357152; ENSG00000158481
GeneIDⁱ	911
KEGGⁱ	hsa:911
UCSC genome browser More...UCSCⁱ	uc001fru.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P29017	cDNA FLJ61149, highly similar to T-cell surface glycoprotein CD1c		HUMAN		136	UniRef100_P29017

Protein	Similar proteins		Species	Score	Length	Source
P29017	cDNA FLJ61149, highly similar to T-cell surface glycoprotein CD1c		HUMAN		136	UniRef90_P29017
CD1C isoform 2 (Fragment)		PANTR		280
CD1C isoform 2 (Fragment)		PONAB		280
Uncharacterized protein (Fragment)		MACFA		277
UPI0004F03BF4		PANPA		346
+5

Protein	Similar proteins		Species	Score	Length	Source
P29017	Isoform 3 of T-cell surface glycoprotein CD1e, membrane-associated		HUMAN		290	UniRef50_P15812-3
T-cell surface glycoprotein CD1b-2		SHEEP		333
T-cell surface glycoprotein CD1a-like		TARSY		318
CD1 protein		HORSE		351
Uncharacterized protein		FELCA		331
+98

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M22178 , M22174, M22175, M22176, M22177 Genomic DNA Translation: AAA51942.1 M28827 mRNA Translation: AAA51941.1 CR457080 mRNA Translation: CAG33361.1 AL121986 Genomic DNA No translation available. BC126465 mRNA Translation: AAI26466.1 BC126467 mRNA Translation: AAI26468.1 AF142667 Genomic DNA Translation: AAD37580.1 M14667 Genomic DNA Translation: AAA51938.1
CCDSⁱ	CCDS1175.1
PIRⁱ	C45801 HLHUCC
RefSeqⁱ	NP_001756.2, NM_001765.2
UniGeneⁱ	Hs.132448

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3OV6	X-ray	2.50	A	19-201	[»]
	4ONO	X-ray	2.70	A	24-201	[»]
	5C9J	X-ray	2.40	A	24-203	[»]
	6C09	X-ray	2.95	A	19-297	[»]
	6C15	X-ray	3.21	A	19-297	[»]
ProteinModelPortalⁱ	P29017
SMRⁱ	P29017
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

IntActⁱ	P29017, 2 interactors
STRINGⁱ	9606.ENSP00000357152

PTM databases

iPTMnetⁱ	P29017
PhosphoSitePlusⁱ	P29017
SwissPalmⁱ	P29017

Polymorphism and mutation databases

BioMutaⁱ	CD1C
DMDMⁱ	143811371

Proteomic databases

MaxQBⁱ	P29017
PaxDbⁱ	P29017
PeptideAtlasⁱ	P29017
PRIDEⁱ	P29017
ProteomicsDBⁱ	54513

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	911
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000368170; ENSP00000357152; ENSG00000158481
GeneIDⁱ	911
KEGGⁱ	hsa:911
UCSCⁱ	uc001fru.4 human

Organism-specific databases

CTDⁱ	911
DisGeNETⁱ	911
EuPathDBⁱ	HostDB:ENSG00000158481.12
GeneCardsⁱ	CD1C
HGNCⁱ	HGNC:1636 CD1C
MIMⁱ	188340 gene
neXtProtⁱ	NX_P29017
OpenTargetsⁱ	ENSG00000158481
PharmGKBⁱ	PA26195
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410JACG Eukaryota ENOG41113WA LUCA
GeneTreeⁱ	ENSGT00480000042665
HOGENOMⁱ	HOG000111666
HOVERGENⁱ	HBG004453
InParanoidⁱ	P29017
KOⁱ	K06448
OMAⁱ	ILYWGHH
OrthoDBⁱ	EOG091G0H36
PhylomeDBⁱ	P29017
TreeFamⁱ	TF336723

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

ChiTaRSⁱ	CD1C human
EvolutionaryTraceⁱ	P29017
GenomeRNAiⁱ	911
Protein Ontology More...PROⁱ	PR:P29017
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000158481 Expressed in 138 organ(s), highest expression level in thymus
CleanExⁱ	HS_CD1C
ExpressionAtlasⁱ	P29017 baseline and differential
Genevisibleⁱ	P29017 HS

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit 3.30.500.10, 1 hit
InterProⁱ	View protein in InterPro IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003597 Ig_C1-set IPR011161 MHC_I-like_Ag-recog IPR037055 MHC_I-like_Ag-recog_sf IPR011162 MHC_I/II-like_Ag-recog
Pfamⁱ	View protein in Pfam PF07654 C1-set, 1 hit PF16497 MHC_I_3, 1 hit
SMARTⁱ	View protein in SMART SM00407 IGc1, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit SSF54452 SSF54452, 1 hit
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CD1C_HUMAN
Accessionⁱ	P29017Primary (citable) accession number: P29017 Secondary accession number(s): Q5TDJ7 , Q6IAS4, Q9UMM0, Q9UN96
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	December 1, 1992
	Last sequence update:	April 3, 2007
	Last modified:	November 7, 2018
	This is version 167 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P29017 (CD1C_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

T-cell surface glycoprotein CD1c

CD1C

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endosome

Plasma membrane

Lysosome

Endosome

Lysosome

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Motif

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ