Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Retinoblastoma-like protein 1

Gene

RBL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation. Forms a complex with adenovirus E1A and with SV40 large T antigen. May bind and modulate functionally certain cellular proteins with which T and E1A compete for pocket binding. May act as a tumor suppressor.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • promoter-specific chromatin binding Source: MGI
  • RNA polymerase II activating transcription factor binding Source: GO_Central
  • RNA polymerase II regulatory region DNA binding Source: GO_Central
  • transcription factor binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, Repressor
Biological processCell cycle, Host-virus interaction, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-1362300 Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1
R-HSA-1538133 G0 and Early G1
R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-69231 Cyclin D associated events in G1

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P28749

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Retinoblastoma-like protein 1
Alternative name(s):
107 kDa retinoblastoma-associated protein
Short name:
p107
pRb1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RBL1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000080839.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9893 RBL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
116957 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P28749

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi640S → A: Strongly reduces phosphorylation by CDK2 and CDK4. 1 Publication1
Mutagenesisi643S → R: No effect on S-640 phosphorylation, but strongly increases S-640 phosphorylation; when associated with 657-A--A-660. 1 Publication1
Mutagenesisi650S → A: No effect on phosphorylation by CDK2. 1 Publication1
Mutagenesisi657 – 660KRRL → AAAA: Reduces S-640 phosphorylation by CDK2 and CDK4. 1 Publication4

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
5933

Open Targets

More...
OpenTargetsi
ENSG00000080839

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34257

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
90103515

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001678391 – 1068Retinoblastoma-like protein 1Add BLAST1068

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei332Phosphothreonine; by CDK2Combined sources1 Publication1
Modified residuei369Phosphothreonine; by CDK4Combined sources2 Publications1
Modified residuei385Phosphothreonine; by CDK2Combined sources1 Publication1
Modified residuei640Phosphoserine; by CDK2 and CDK4Combined sources1 Publication1
Modified residuei650Phosphoserine1 Publication1
Modified residuei749PhosphoserineCombined sources1
Modified residuei762Phosphoserine; by CDK2Combined sources1 Publication1
Modified residuei964Phosphoserine; by CDK2 and CDK41 Publication1
Modified residuei975Phosphoserine; by CDK2 and CDK41 Publication1
Modified residuei988Phosphoserine; by CDK2Combined sources1 Publication1
Modified residuei997Phosphothreonine; by CDK21 Publication1
Modified residuei1009Phosphoserine; by CDK21 Publication1
Modified residuei1041PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Exists in both phosphorylated and unphosphorylated forms, and T, but not E1A, binds only to the unphosphorylated form. Cell-cycle arrest properties are inactivated by phosphorylation on Thr-332, Ser-640, Ser-964 and Ser-975 by CDK4.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P28749

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P28749

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P28749

PeptideAtlas

More...
PeptideAtlasi
P28749

PRoteomics IDEntifications database

More...
PRIDEi
P28749

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54497
54498 [P28749-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P28749

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P28749

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000080839 Expressed in 184 organ(s), highest expression level in buccal mucosa cell

CleanEx database of gene expression profiles

More...
CleanExi
HS_RBL1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P28749 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P28749 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA054962
HPA056525

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with KMT5B, KMT5C and USP4 (By similarity). Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. Interacts with AATF. Interacts with KDM5A.By similarity4 Publications
(Microbial infection) Interacts with SV40 and JC virus large T antigens.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111868, 75 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P28749

Database of interacting proteins

More...
DIPi
DIP-148N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P28749

Protein interaction database and analysis system

More...
IntActi
P28749, 42 interactors

Molecular INTeraction database

More...
MINTi
P28749

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362768

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11068
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P28749

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P28749

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P28749

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni385 – 949Pocket; binds T and E1AAdd BLAST565
Regioni385 – 584Domain AAdd BLAST200
Regioni585 – 780SpacerAdd BLAST196
Regioni781 – 949Domain BAdd BLAST169

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the retinoblastoma protein (RB) family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1010 Eukaryota
ENOG410XQF7 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153871

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000273892

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG017710

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P28749

KEGG Orthology (KO)

More...
KOi
K04681

Identification of Orthologs from Complete Genome Data

More...
OMAi
LRPFYFY

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0398

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P28749

TreeFam database of animal gene trees

More...
TreeFami
TF105568

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00043 CYCLIN, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR002720 RB_A
IPR002719 RB_B
IPR015030 RB_C
IPR028309 RB_fam
IPR024599 RB_N
IPR028310 RBL1

The PANTHER Classification System

More...
PANTHERi
PTHR13742 PTHR13742, 1 hit
PTHR13742:SF20 PTHR13742:SF20, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11934 DUF3452, 1 hit
PF01858 RB_A, 1 hit
PF01857 RB_B, 1 hit
PF08934 Rb_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00385 CYCLIN, 1 hit
SM01367 DUF3452, 1 hit
SM01368 RB_A, 1 hit
SM01369 Rb_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47954 SSF47954, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P28749-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFEDKPHAEG AAVVAAAGEA LQALCQELNL DEGSAAEALD DFTAIRGNYS
60 70 80 90 100
LEGEVTHWLA CSLYVACRKS IIPTVGKGIM EGNCVSLTRI LRSAKLSLIQ
110 120 130 140 150
FFSKMKKWMD MSNLPQEFRE RIERLERNFE VSTVIFKKYE PIFLDIFQNP
160 170 180 190 200
YEEPPKLPRS RKQRRIPCSV KDLFNFCWTL FVYTKGNFRM IGDDLVNSYH
210 220 230 240 250
LLLCCLDLIF ANAIMCPNRQ DLLNPSFKGL PSDFHTADFT ASEEPPCIIA
260 270 280 290 300
VLCELHDGLL VEAKGIKEHY FKPYISKLFD RKILKGECLL DLSSFTDNSK
310 320 330 340 350
AVNKEYEEYV LTVGDFDERI FLGADAEEEI GTPRKFTRDT PLGKLTAQAN
360 370 380 390 400
VEYNLQQHFE KKRSFAPSTP LTGRRYLREK EAVITPVASA TQSVSRLQSI
410 420 430 440 450
VAGLKNAPSD QLINIFESCV RNPVENIMKI LKGIGETFCQ HYTQSTDEQP
460 470 480 490 500
GSHIDFAVNR LKLAEILYYK ILETVMVQET RRLHGMDMSV LLEQDIFHRS
510 520 530 540 550
LMACCLEIVL FAYSSPRTFP WIIEVLNLQP FYFYKVIEVV IRSEEGLSRD
560 570 580 590 600
MVKHLNSIEE QILESLAWSH DSALWEALQV SANKVPTCEE VIFPNNFETG
610 620 630 640 650
NGGNVQGHLP LMPMSPLMHP RVKEVRTDSG SLRRDMQPLS PISVHERYSS
660 670 680 690 700
PTAGSAKRRL FGEDPPKEML MDKIITEGTK LKIAPSSSIT AENVSILPGQ
710 720 730 740 750
TLLTMATAPV TGTTGHKVTI PLHGVANDAG EITLIPLSMN TNQESKVKSP
760 770 780 790 800
VSLTAHSLIG ASPKQTNLTK AQEVHSTGIN RPKRTGSLAL FYRKVYHLAS
810 820 830 840 850
VRLRDLCLKL DVSNELRRKI WTCFEFTLVH CPDLMKDRHL DQLLLCAFYI
860 870 880 890 900
MAKVTKEERT FQEIMKSYRN QPQANSHVYR SVLLKSIPRE VVAYNKNIND
910 920 930 940 950
DFEMIDCDLE DATKTPDCSS GPVKEERGDL IKFYNTIYVG RVKSFALKYD
960 970 980 990 1000
LANQDHMMDA PPLSPFPHIK QQPGSPRRIS QQHSIYISPH KNGSGLTPRS
1010 1020 1030 1040 1050
ALLYKFNGSP SKSLKDINNM IRQGEQRTKK RVIAIDSDAE SPAKRVCQEN
1060
DDVLLKRLQD VVSERANH
Length:1,068
Mass (Da):120,847
Last modified:March 7, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2BC4876EA04BDB31
GO
Isoform 2 (identifier: P28749-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1013-1068: SLKDINNMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH → VR

Show »
Length:1,014
Mass (Da):114,688
Checksum:iCE1D47DBF365C4CB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YE05H0YE05_HUMAN
Retinoblastoma-like protein 1
RBL1
254Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNB6E9PNB6_HUMAN
Retinoblastoma-like protein 1
RBL1
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti326Missing AA sequence (PubMed:11884610).Curated1
Sequence conflicti928G → S (PubMed:8319904).Curated1
Sequence conflicti928G → S (PubMed:1833063).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0344431035I → M. Corresponds to variant dbSNP:rs8114297Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0174961013 – 1068SLKDI…ERANH → VR in isoform 2. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L14812 mRNA Translation: AAA02489.1
AK290380 mRNA Translation: BAF83069.1
AL136172 Genomic DNA No translation available.
AL365505 Genomic DNA No translation available.
AL391114 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76088.1
BC032247 mRNA Translation: AAH32247.1
M74547 mRNA Translation: AAA36397.1
S78664 Genomic DNA Translation: AAD14290.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13289.1 [P28749-1]
CCDS13290.1 [P28749-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A47319 A40265

NCBI Reference Sequences

More...
RefSeqi
NP_002886.2, NM_002895.4 [P28749-1]
NP_899662.1, NM_183404.3 [P28749-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.207745

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000344359; ENSP00000343646; ENSG00000080839 [P28749-2]
ENST00000373664; ENSP00000362768; ENSG00000080839 [P28749-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5933

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5933

UCSC genome browser

More...
UCSCi
uc002xgi.5 human [P28749-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L14812 mRNA Translation: AAA02489.1
AK290380 mRNA Translation: BAF83069.1
AL136172 Genomic DNA No translation available.
AL365505 Genomic DNA No translation available.
AL391114 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76088.1
BC032247 mRNA Translation: AAH32247.1
M74547 mRNA Translation: AAA36397.1
S78664 Genomic DNA Translation: AAD14290.1
CCDSiCCDS13289.1 [P28749-1]
CCDS13290.1 [P28749-2]
PIRiA47319 A40265
RefSeqiNP_002886.2, NM_002895.4 [P28749-1]
NP_899662.1, NM_183404.3 [P28749-2]
UniGeneiHs.207745

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1H28X-ray2.80E/F653-663[»]
4YOOX-ray2.40A391-600[»]
A781-972[»]
4YOSX-ray2.30A391-599[»]
4YOZX-ray2.25A391-593[»]
A777-972[»]
5TUVX-ray2.90C/F994-1031[»]
ProteinModelPortaliP28749
SMRiP28749
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111868, 75 interactors
CORUMiP28749
DIPiDIP-148N
ELMiP28749
IntActiP28749, 42 interactors
MINTiP28749
STRINGi9606.ENSP00000362768

PTM databases

iPTMnetiP28749
PhosphoSitePlusiP28749

Polymorphism and mutation databases

DMDMi90103515

Proteomic databases

EPDiP28749
MaxQBiP28749
PaxDbiP28749
PeptideAtlasiP28749
PRIDEiP28749
ProteomicsDBi54497
54498 [P28749-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5933
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344359; ENSP00000343646; ENSG00000080839 [P28749-2]
ENST00000373664; ENSP00000362768; ENSG00000080839 [P28749-1]
GeneIDi5933
KEGGihsa:5933
UCSCiuc002xgi.5 human [P28749-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5933
DisGeNETi5933
EuPathDBiHostDB:ENSG00000080839.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RBL1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0040570
HGNCiHGNC:9893 RBL1
HPAiHPA054962
HPA056525
MIMi116957 gene
neXtProtiNX_P28749
OpenTargetsiENSG00000080839
PharmGKBiPA34257

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1010 Eukaryota
ENOG410XQF7 LUCA
GeneTreeiENSGT00940000153871
HOGENOMiHOG000273892
HOVERGENiHBG017710
InParanoidiP28749
KOiK04681
OMAiLRPFYFY
OrthoDBiEOG091G0398
PhylomeDBiP28749
TreeFamiTF105568

Enzyme and pathway databases

ReactomeiR-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-1362300 Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1
R-HSA-1538133 G0 and Early G1
R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-69231 Cyclin D associated events in G1
SIGNORiP28749

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RBL1 human
EvolutionaryTraceiP28749

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Retinoblastoma-like_protein_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5933

Protein Ontology

More...
PROi
PR:P28749

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000080839 Expressed in 184 organ(s), highest expression level in buccal mucosa cell
CleanExiHS_RBL1
ExpressionAtlasiP28749 baseline and differential
GenevisibleiP28749 HS

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR002720 RB_A
IPR002719 RB_B
IPR015030 RB_C
IPR028309 RB_fam
IPR024599 RB_N
IPR028310 RBL1
PANTHERiPTHR13742 PTHR13742, 1 hit
PTHR13742:SF20 PTHR13742:SF20, 1 hit
PfamiView protein in Pfam
PF11934 DUF3452, 1 hit
PF01858 RB_A, 1 hit
PF01857 RB_B, 1 hit
PF08934 Rb_C, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SM01367 DUF3452, 1 hit
SM01368 RB_A, 1 hit
SM01369 Rb_C, 1 hit
SUPFAMiSSF47954 SSF47954, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P28749
Secondary accession number(s): A8K2W5
, Q4VXA0, Q8N5K6, Q9H1L5, Q9H1M1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: March 7, 2006
Last modified: December 5, 2018
This is version 198 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again