Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF2A

Gene

Kif2a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity (By similarity).By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi312 – 319ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • microtubule binding Source: MGI
  • microtubule motor activity Source: GO_Central
  • protein kinase binding Source: MGI

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Motor protein
Biological processCell cycle, Cell division, Differentiation, Mitosis, Neurogenesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2132295 MHC class II antigen presentation
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-68877 Mitotic Prometaphase
R-MMU-983189 Kinesins

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Gene namesi
Name:Kif2a
Synonyms:Kif2, Kns2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:108390 Kif2a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Lysosome, Microtubule

Pathology & Biotechi

Disruption phenotypei

Mice show overextension of collateral branches of developing axons and defects in neuronal migration in the brain. They die within 24 hours of birth.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001254151 – 705Kinesin-like protein KIF2AAdd BLAST705

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei75PhosphoserineBy similarity1
Modified residuei96PhosphothreonineBy similarity1
Modified residuei101N6-acetyllysineCombined sources1
Modified residuei134PhosphoserineBy similarity1
Modified residuei139PhosphoserineCombined sources1
Isoform 1 (identifier: P28740-1)
Modified residuei528PhosphoserineCombined sources1
Modified residuei545PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP28740
PeptideAtlasiP28740
PRIDEiP28740

PTM databases

iPTMnetiP28740
PhosphoSitePlusiP28740

Expressioni

Tissue specificityi

Highest level in lung. High level in ovary, moderate levels in heart, kidney, placenta, skeletal muscle and spleen (at protein level). Pancreas and spleen express a shorter isoform (at protein level). Expressed in the flagellum of elongated spermatids and sperm in the testis lumen (at protein level) (PubMed:24339785). Isoform 1 expressed in neuronal cells. Isoform 2 expressed in astrocytes and fibroblasts.2 Publications

Developmental stagei

Isoform 1 expressed at low level in E13 embryonic hippocampus, higher level by stage 15 persisting into juvenile and adult stages. Isoform 2 expressed in E13 and E15 embryonic hippocampus declining to very low levels in juvenile and adult neurons. High level of isoform 1 and very low level of isoform 2 in stage 2 and 5 hippocampal neurons in culture.1 Publication

Gene expression databases

BgeeiENSMUSG00000021693 Expressed in 284 organ(s), highest expression level in blood
CleanExiMM_KIF2A
ExpressionAtlasiP28740 baseline and differential
GenevisibleiP28740 MM

Interactioni

Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi200938, 15 interactors
IntActiP28740, 14 interactors
MINTiP28740

Structurei

3D structure databases

ProteinModelPortaliP28740
SMRiP28740
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini222 – 552Kinesin motorPROSITE-ProRule annotationAdd BLAST331

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 216GlobularSequence analysisAdd BLAST216

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili659 – 698Sequence analysisAdd BLAST40

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00930000150912
HOGENOMiHOG000231329
HOVERGENiHBG003875
InParanoidiP28740
KOiK10393
OMAiITVEWYE
PhylomeDBiP28740
TreeFamiTF105222

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: P28740-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK
60 70 80 90 100
GKEIDLESIF SLNPDLVPDE DIEPSPELPP PSSSSKVNKI VKNRRTVAAV
110 120 130 140 150
KNDPPPRDNR VVGSARARPS QLPEQSSSAQ QNGSVSDISP VQAAKKEFGP
160 170 180 190 200
PSRRKSNCVK EVEKLQEKRE KRRLQQQELR EKRAQDVDAT NPNYEIMCMI
210 220 230 240 250
RDFRGSLDYR PLTTADPIDE HRICVCVRKR PLNKKETQMK DLDVITIPSK
260 270 280 290 300
DVVMVHEPKQ KVDLTRYLEN QTFRFDYAFD DSAPNEMVYR FTARPLVETI
310 320 330 340 350
FERGMATCFA YGQTGSGKTH TMGGDFSGKN QDCSKGIYAL AARDVFLMLK
360 370 380 390 400
KPNYKKLELQ VYATFFEIYS GKVFDLLNRK TKLRVLEDGK QQVQVVGLQE
410 420 430 440 450
REVKCVEDVL KLIDIGNSCR TSGQTSANAH SSRSHAVFQI ILRRKGKLHG
460 470 480 490 500
KFSLIDLAGN ERGADTSSAD RQTRLEGAEI NKSLLALKEC IRALGRNKPH
510 520 530 540 550
TPFRASKLTQ VLRDSFIGEN SRTCMIATIS PGMASCENTL NTLRYANRVK
560 570 580 590 600
ELTVNPAAAG DVHPIMHHPP SQIDDLETQW GVGSSPQRDD LKLLCEQNEE
610 620 630 640 650
EVSPQLFTFH EAVSQMVEME EQVVEDHRAV FQESIRWIED EKALLEMTEE
660 670 680 690 700
VDYDVDSYAT QLEAILEQKI DILTELRDKV KSFRAALQEE EQASKQINPK

RPRAL
Length:705
Mass (Da):79,756
Last modified:October 2, 2007 - v2
Checksum:iACEBB35CC0F4A68E
GO
Isoform 1 (identifier: P28740-1) [UniParc]FASTAAdd to basket
Also known as: Kif2

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     551-551: E → EFGISPSDIPFSQGGGSRPDLSPSYDYDDFSPSITRVKE

Show »
Length:716
Mass (Da):80,861
Checksum:i6655DA8F001DC51B
GO
Isoform 2 (identifier: P28740-2) [UniParc]FASTAAdd to basket
Also known as: Kif2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     133-152: GSVSDISPVQAAKKEFGPPS → A

Show »
Length:659
Mass (Da):74,845
Checksum:i32482C9FE134CF96
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E0CZ72E0CZ72_MOUSE
Kinesin-like protein
Kif2a
743Annotation score:
F8VQ42F8VQ42_MOUSE
Kinesin-like protein
Kif2a
671Annotation score:
F6RLL5F6RLL5_MOUSE
Kinesin-like protein KIF2A
Kif2a
96Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti99A → ARA in CAA75815 (PubMed:9774330).Curated1
Sequence conflicti117 – 118Missing in CAA75815 (PubMed:9774330).Curated2
Sequence conflicti486A → R in BAA02165 (PubMed:1447303).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0283771 – 27Missing in isoform 1 and isoform 2. 2 PublicationsAdd BLAST27
Alternative sequenceiVSP_028378133 – 152GSVSD…FGPPS → A in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_028379551E → EFGISPSDIPFSQGGGSRPD LSPSYDYDDFSPSITRVKE in isoform 1. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12644 mRNA Translation: BAA02165.1
Y15894 mRNA Translation: CAA75815.1
BC006803 mRNA Translation: AAH06803.2
CCDSiCCDS26759.1 [P28740-1]
CCDS49356.1 [P28740-3]
PIRiA44259
RefSeqiNP_001139251.1, NM_001145779.1 [P28740-3]
XP_006517602.1, XM_006517539.3 [P28740-2]
UniGeneiMm.355686

Genome annotation databases

EnsembliENSMUST00000022204; ENSMUSP00000022204; ENSMUSG00000021693 [P28740-3]
ENSMUST00000117423; ENSMUSP00000113921; ENSMUSG00000021693 [P28740-2]
ENSMUST00000122233; ENSMUSP00000112715; ENSMUSG00000021693 [P28740-1]
GeneIDi16563
KEGGimmu:16563
UCSCiuc007rub.2 mouse [P28740-3]
uc007ruc.2 mouse [P28740-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12644 mRNA Translation: BAA02165.1
Y15894 mRNA Translation: CAA75815.1
BC006803 mRNA Translation: AAH06803.2
CCDSiCCDS26759.1 [P28740-1]
CCDS49356.1 [P28740-3]
PIRiA44259
RefSeqiNP_001139251.1, NM_001145779.1 [P28740-3]
XP_006517602.1, XM_006517539.3 [P28740-2]
UniGeneiMm.355686

3D structure databases

ProteinModelPortaliP28740
SMRiP28740
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200938, 15 interactors
IntActiP28740, 14 interactors
MINTiP28740

PTM databases

iPTMnetiP28740
PhosphoSitePlusiP28740

Proteomic databases

EPDiP28740
PeptideAtlasiP28740
PRIDEiP28740

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022204; ENSMUSP00000022204; ENSMUSG00000021693 [P28740-3]
ENSMUST00000117423; ENSMUSP00000113921; ENSMUSG00000021693 [P28740-2]
ENSMUST00000122233; ENSMUSP00000112715; ENSMUSG00000021693 [P28740-1]
GeneIDi16563
KEGGimmu:16563
UCSCiuc007rub.2 mouse [P28740-3]
uc007ruc.2 mouse [P28740-1]

Organism-specific databases

CTDi3796
MGIiMGI:108390 Kif2a

Phylogenomic databases

GeneTreeiENSGT00930000150912
HOGENOMiHOG000231329
HOVERGENiHBG003875
InParanoidiP28740
KOiK10393
OMAiITVEWYE
PhylomeDBiP28740
TreeFamiTF105222

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2132295 MHC class II antigen presentation
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-68877 Mitotic Prometaphase
R-MMU-983189 Kinesins

Miscellaneous databases

PROiPR:P28740
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021693 Expressed in 284 organ(s), highest expression level in blood
CleanExiMM_KIF2A
ExpressionAtlasiP28740 baseline and differential
GenevisibleiP28740 MM

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKIF2A_MOUSE
AccessioniPrimary (citable) accession number: P28740
Secondary accession number(s): O54744, Q91W03
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: October 2, 2007
Last modified: November 7, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again