Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myeloid zinc finger 1

Gene

MZF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds to target promoter DNA and functions as transcription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri356 – 378C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri384 – 406C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri412 – 434C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri440 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri485 – 507C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri513 – 535C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri541 – 563C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri569 – 591C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri597 – 619C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri625 – 647C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri653 – 675C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri681 – 703C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri709 – 731C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLinkiP28698
SIGNORiP28698

Names & Taxonomyi

Protein namesi
Recommended name:
Myeloid zinc finger 1
Short name:
MZF-1
Alternative name(s):
Zinc finger and SCAN domain-containing protein 6
Zinc finger protein 42
Gene namesi
Name:MZF1
Synonyms:MZF, ZNF42, ZSCAN6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000099326.8
HGNCiHGNC:13108 MZF1
MIMi194550 gene
neXtProtiNX_P28698

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7593
OpenTargetsiENSG00000099326
PharmGKBiPA37683

Polymorphism and mutation databases

BioMutaiMZF1
DMDMi215274121

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000473751 – 734Myeloid zinc finger 1Add BLAST734

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei111PhosphoserineCombined sources1
Cross-linki723Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP28698
PaxDbiP28698
PeptideAtlasiP28698
PRIDEiP28698
ProteomicsDBi54492
54493 [P28698-2]

PTM databases

iPTMnetiP28698
PhosphoSitePlusiP28698

Expressioni

Tissue specificityi

Preferentially expressed in differentiating myeloid cells. Detected in osteoblasts.1 Publication

Inductioni

By retinoic acid.

Gene expression databases

BgeeiENSG00000099326 Expressed in 216 organ(s), highest expression level in right uterine tube
CleanExiHS_MZF1
ExpressionAtlasiP28698 baseline and differential
GenevisibleiP28698 HS

Organism-specific databases

HPAiHPA001757

Interactioni

Subunit structurei

Homodimer.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi113419, 16 interactors
IntActiP28698, 3 interactors
STRINGi9606.ENSP00000215057

Structurei

Secondary structure

1734
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP28698
SMRiP28698
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP28698

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini44 – 125SCAN boxPROSITE-ProRule annotationAdd BLAST82

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi310 – 321Asp/Glu-rich (acidic)Add BLAST12
Compositional biasi463 – 484Gly/Pro-richAdd BLAST22

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri356 – 378C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri384 – 406C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri412 – 434C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri440 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri485 – 507C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri513 – 535C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri541 – 563C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri569 – 591C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri597 – 619C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri625 – 647C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri653 – 675C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri681 – 703C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri709 – 731C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00730000111047
HOGENOMiHOG000234619
HOVERGENiHBG062666
InParanoidiP28698
KOiK09221
OMAiQPFRCAE
OrthoDBiEOG091G02KC
PhylomeDBiP28698
TreeFamiTF337913

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 11 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 13 hits
SUPFAMiSSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 13 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform MZF1A (identifier: P28698-1) [UniParc]FASTAAdd to basket
Also known as: MZF1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPAVLGSPD RAPPEDEGPV MVKLEDSEEE GEAALWDPGP EAARLRFRCF
60 70 80 90 100
RYEEATGPQE ALAQLRELCR QWLRPEVRSK EQMLELLVLE QFLGALPPEI
110 120 130 140 150
QARVQGQRPG SPEEAAALVD GLRREPGGPR RWVTVQVQGQ EVLSEKMEPS
160 170 180 190 200
SFQPLPETEP PTPEPGPKTP PRTMQESPLG LQVKEESEVT EDSDFLESGP
210 220 230 240 250
LAATQESVPT LLPEEAQRCG TVLDQIFPHS KTGPEGPSWR EHPRALWHEE
260 270 280 290 300
AGGIFSPGFA LQLGSISAGP GSVSPHLHVP WDLGMAGLSG QIQSPSREGG
310 320 330 340 350
FAHALLLPSD LRSEQDPTDE DPCRGVGPAL ITTRWRSPRG RSRGRPSTGG
360 370 380 390 400
GVVRGGRCDV CGKVFSQRSN LLRHQKIHTG ERPFVCSECG RSFSRSSHLL
410 420 430 440 450
RHQLTHTEER PFVCGDCGQG FVRSARLEEH RRVHTGEQPF RCAECGQSFR
460 470 480 490 500
QRSNLLQHQR IHGDPPGPGA KPPAPPGAPE PPGPFPCSEC RESFARRAVL
510 520 530 540 550
LEHQAVHTGD KSFGCVECGE RFGRRSVLLQ HRRVHSGERP FACAECGQSF
560 570 580 590 600
RQRSNLTQHR RIHTGERPFA CAECGKAFRQ RPTLTQHLRV HTGEKPFACP
610 620 630 640 650
ECGQRFSQRL KLTRHQRTHT GEKPYHCGEC GLGFTQVSRL TEHQRIHTGE
660 670 680 690 700
RPFACPECGQ SFRQHANLTQ HRRIHTGERP YACPECGKAF RQRPTLTQHL
710 720 730
RTHRREKPFA CQDCGRRFHQ STKLIQHQRV HSAE
Length:734
Mass (Da):82,055
Last modified:November 25, 2008 - v3
Checksum:iB804766A0B008048
GO
Isoform MZF1B-C (identifier: P28698-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-249: Missing.
     250-257: EAGGIFSP → MNGPLVYA

Show »
Length:485
Mass (Da):54,392
Checksum:i60243378A7B2B6F4
GO
Isoform 3 (identifier: P28698-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     259-290: FALQLGSISAGPGSVSPHLHVPWDLGMAGLSG → AGAGAAPALGAGWLGAAVAMYVARCSANAATC
     291-734: Missing.

Show »
Length:290
Mass (Da):31,460
Checksum:i28940B137E71394F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R1U5M0R1U5_HUMAN
Myeloid zinc finger 1
MZF1
259Annotation score:
M0R2C0M0R2C0_HUMAN
Myeloid zinc finger 1
MZF1
63Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti304 – 305AL → RV in AAA59898 (PubMed:1860835).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04767751R → H2 PublicationsCorresponds to variant dbSNP:rs3752109Ensembl.1
Natural variantiVAR_047678103R → H. Corresponds to variant dbSNP:rs3752110Ensembl.1
Natural variantiVAR_047679130R → Q. Corresponds to variant dbSNP:rs3752111Ensembl.1
Natural variantiVAR_014826331I → V. Corresponds to variant dbSNP:rs4756Ensembl.1
Natural variantiVAR_047680441R → P. Corresponds to variant dbSNP:rs2229255Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0068891 – 249Missing in isoform MZF1B-C. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_006890250 – 257EAGGIFSP → MNGPLVYA in isoform MZF1B-C. 1 Publication8
Alternative sequenceiVSP_047013259 – 290FALQL…AGLSG → AGAGAAPALGAGWLGAAVAM YVARCSANAATC in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_047014291 – 734Missing in isoform 3. 1 PublicationAdd BLAST444

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58297 mRNA Translation: AAA59898.1
AF055077 mRNA Translation: AAD55809.1
AF055078 mRNA Translation: AAD55810.1
AF161886 Genomic DNA Translation: AAF80465.1
AF161886 Genomic DNA Translation: AAF80466.1
AC016629 Genomic DNA No translation available.
AC016630 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72617.1
BC007777 mRNA Translation: AAH07777.1
BC053316 mRNA Translation: AAH53316.1
CCDSiCCDS12988.1 [P28698-1]
CCDS59427.1 [P28698-3]
PIRiA40751
RefSeqiNP_001253962.1, NM_001267033.1 [P28698-3]
NP_003413.2, NM_003422.2 [P28698-1]
NP_932172.1, NM_198055.1 [P28698-1]
UniGeneiHs.399810
Hs.684624

Genome annotation databases

EnsembliENST00000215057; ENSP00000215057; ENSG00000099326 [P28698-1]
ENST00000594234; ENSP00000469378; ENSG00000099326 [P28698-3]
ENST00000599369; ENSP00000469493; ENSG00000099326 [P28698-1]
GeneIDi7593
KEGGihsa:7593
UCSCiuc002qtn.4 human [P28698-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58297 mRNA Translation: AAA59898.1
AF055077 mRNA Translation: AAD55809.1
AF055078 mRNA Translation: AAD55810.1
AF161886 Genomic DNA Translation: AAF80465.1
AF161886 Genomic DNA Translation: AAF80466.1
AC016629 Genomic DNA No translation available.
AC016630 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72617.1
BC007777 mRNA Translation: AAH07777.1
BC053316 mRNA Translation: AAH53316.1
CCDSiCCDS12988.1 [P28698-1]
CCDS59427.1 [P28698-3]
PIRiA40751
RefSeqiNP_001253962.1, NM_001267033.1 [P28698-3]
NP_003413.2, NM_003422.2 [P28698-1]
NP_932172.1, NM_198055.1 [P28698-1]
UniGeneiHs.399810
Hs.684624

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2FI2NMR-A/B37-128[»]
ProteinModelPortaliP28698
SMRiP28698
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113419, 16 interactors
IntActiP28698, 3 interactors
STRINGi9606.ENSP00000215057

PTM databases

iPTMnetiP28698
PhosphoSitePlusiP28698

Polymorphism and mutation databases

BioMutaiMZF1
DMDMi215274121

Proteomic databases

MaxQBiP28698
PaxDbiP28698
PeptideAtlasiP28698
PRIDEiP28698
ProteomicsDBi54492
54493 [P28698-2]

Protocols and materials databases

DNASUi7593
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000215057; ENSP00000215057; ENSG00000099326 [P28698-1]
ENST00000594234; ENSP00000469378; ENSG00000099326 [P28698-3]
ENST00000599369; ENSP00000469493; ENSG00000099326 [P28698-1]
GeneIDi7593
KEGGihsa:7593
UCSCiuc002qtn.4 human [P28698-1]

Organism-specific databases

CTDi7593
DisGeNETi7593
EuPathDBiHostDB:ENSG00000099326.8
GeneCardsiMZF1
HGNCiHGNC:13108 MZF1
HPAiHPA001757
MIMi194550 gene
neXtProtiNX_P28698
OpenTargetsiENSG00000099326
PharmGKBiPA37683
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00730000111047
HOGENOMiHOG000234619
HOVERGENiHBG062666
InParanoidiP28698
KOiK09221
OMAiQPFRCAE
OrthoDBiEOG091G02KC
PhylomeDBiP28698
TreeFamiTF337913

Enzyme and pathway databases

SignaLinkiP28698
SIGNORiP28698

Miscellaneous databases

EvolutionaryTraceiP28698
GeneWikiiMZF1
GenomeRNAii7593
PROiPR:P28698
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000099326 Expressed in 216 organ(s), highest expression level in right uterine tube
CleanExiHS_MZF1
ExpressionAtlasiP28698 baseline and differential
GenevisibleiP28698 HS

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 11 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 13 hits
SUPFAMiSSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 13 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits
ProtoNetiSearch...

Entry informationi

Entry nameiMZF1_HUMAN
AccessioniPrimary (citable) accession number: P28698
Secondary accession number(s): M0QXU0
, Q7Z729, Q96I71, Q9NRY0, Q9UBW2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: November 25, 2008
Last modified: November 7, 2018
This is version 189 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again