Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P28698 (MZF1_HUMAN)

Entry version 199 (13 Nov 2019)
Sequence version 3 (25 Nov 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Myeloid zinc finger 1

Gene

MZF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to target promoter DNA and functions as transcription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri356 – 378C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri384 – 406C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri412 – 434C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri440 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri485 – 507C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri513 – 535C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri541 – 563C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri569 – 591C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri597 – 619C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri625 – 647C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri653 – 675C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri681 – 703C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri709 – 731C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P28698

SIGNOR Signaling Network Open Resource

More...SIGNORi		P28698

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myeloid zinc finger 1
Short name:
MZF-1
Alternative name(s):
Zinc finger and SCAN domain-containing protein 6
Zinc finger protein 42
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MZF1
Synonyms:MZF, ZNF42, ZSCAN6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:13108 MZF1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		194550 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P28698

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		7593

Open Targets

More...OpenTargetsi		ENSG00000099326

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37683

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P28698

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MZF1

Domain mapping of disease mutations (DMDM)

More...DMDMi		215274121

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000473751 – 734Myeloid zinc finger 1Add BLAST734

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei111PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki723Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P28698

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P28698

MaxQB - The MaxQuant DataBase

More...MaxQBi		P28698

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P28698

PeptideAtlas

More...PeptideAtlasi		P28698

PRoteomics IDEntifications database

More...PRIDEi		P28698

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54492 [P28698-1]
54493 [P28698-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P28698

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P28698

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Preferentially expressed in differentiating myeloid cells. Detected in osteoblasts.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By retinoic acid.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000099326 Expressed in 216 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P28698 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P28698 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA001757

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		113419, 16 interactors

Protein interaction database and analysis system

More...IntActi		P28698, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000215057

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1734
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P28698

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P28698

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini44 – 125SCAN boxPROSITE-ProRule annotationAdd BLAST82

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi310 – 321Asp/Glu-rich (acidic)Add BLAST12
Compositional biasi463 – 484Gly/Pro-richAdd BLAST22

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri356 – 378C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri384 – 406C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri412 – 434C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri440 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri485 – 507C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri513 – 535C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri541 – 563C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri569 – 591C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri597 – 619C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri625 – 647C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri653 – 675C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri681 – 703C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri709 – 731C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182890

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000234619

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P28698

KEGG Orthology (KO)

More...KOi		K09221

Identification of Orthologs from Complete Genome Data

More...OMAi		WHEEAGG

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P28698

TreeFam database of animal gene trees

More...TreeFami		TF337913

Family and domain databases

Conserved Domains Database

More...CDDi		cd07936 SCAN, 1 hit

Database of protein disorder

More...DisProti		DP02096

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.4020.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 11 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 13 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667 SSF57667, 7 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 13 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform MZF1A (identifier: P28698-1) [UniParc]FASTAAdd to basket
Also known as: MZF1B

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPAVLGSPD RAPPEDEGPV MVKLEDSEEE GEAALWDPGP EAARLRFRCF 
        60         70         80         90        100
RYEEATGPQE ALAQLRELCR QWLRPEVRSK EQMLELLVLE QFLGALPPEI 
       110        120        130        140        150
QARVQGQRPG SPEEAAALVD GLRREPGGPR RWVTVQVQGQ EVLSEKMEPS 
       160        170        180        190        200
SFQPLPETEP PTPEPGPKTP PRTMQESPLG LQVKEESEVT EDSDFLESGP 
       210        220        230        240        250
LAATQESVPT LLPEEAQRCG TVLDQIFPHS KTGPEGPSWR EHPRALWHEE 
       260        270        280        290        300
AGGIFSPGFA LQLGSISAGP GSVSPHLHVP WDLGMAGLSG QIQSPSREGG 
       310        320        330        340        350
FAHALLLPSD LRSEQDPTDE DPCRGVGPAL ITTRWRSPRG RSRGRPSTGG 
       360        370        380        390        400
GVVRGGRCDV CGKVFSQRSN LLRHQKIHTG ERPFVCSECG RSFSRSSHLL 
       410        420        430        440        450
RHQLTHTEER PFVCGDCGQG FVRSARLEEH RRVHTGEQPF RCAECGQSFR 
       460        470        480        490        500
QRSNLLQHQR IHGDPPGPGA KPPAPPGAPE PPGPFPCSEC RESFARRAVL 
       510        520        530        540        550
LEHQAVHTGD KSFGCVECGE RFGRRSVLLQ HRRVHSGERP FACAECGQSF 
       560        570        580        590        600
RQRSNLTQHR RIHTGERPFA CAECGKAFRQ RPTLTQHLRV HTGEKPFACP 
       610        620        630        640        650
ECGQRFSQRL KLTRHQRTHT GEKPYHCGEC GLGFTQVSRL TEHQRIHTGE 
       660        670        680        690        700
RPFACPECGQ SFRQHANLTQ HRRIHTGERP YACPECGKAF RQRPTLTQHL 
       710        720        730 
RTHRREKPFA CQDCGRRFHQ STKLIQHQRV HSAE
Length:734
Mass (Da):82,055
Last modified:November 25, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB804766A0B008048
GO
Isoform MZF1B-C (identifier: P28698-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-249: Missing.
     250-257: EAGGIFSP → MNGPLVYA

Show »
Length:485
Mass (Da):54,392
Checksum:i60243378A7B2B6F4
GO
Isoform 3 (identifier: P28698-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     259-290: FALQLGSISAGPGSVSPHLHVPWDLGMAGLSG → AGAGAAPALGAGWLGAAVAMYVARCSANAATC
     291-734: Missing.

Show »
Length:290
Mass (Da):31,460
Checksum:i28940B137E71394F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R1U5M0R1U5_HUMAN
Myeloid zinc finger 1
MZF1
259Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R2C0M0R2C0_HUMAN
Myeloid zinc finger 1
MZF1
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti304 – 305AL → RV in AAA59898 (PubMed:1860835).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04767751R → H2 PublicationsCorresponds to variant dbSNP:rs3752109Ensembl.1
Natural variantiVAR_047678103R → H. Corresponds to variant dbSNP:rs3752110Ensembl.1
Natural variantiVAR_047679130R → Q. Corresponds to variant dbSNP:rs3752111Ensembl.1
Natural variantiVAR_014826331I → V. Corresponds to variant dbSNP:rs4756Ensembl.1
Natural variantiVAR_047680441R → P. Corresponds to variant dbSNP:rs2229255Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0068891 – 249Missing in isoform MZF1B-C. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_006890250 – 257EAGGIFSP → MNGPLVYA in isoform MZF1B-C. 1 Publication8
Alternative sequenceiVSP_047013259 – 290FALQL…AGLSG → AGAGAAPALGAGWLGAAVAM YVARCSANAATC in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_047014291 – 734Missing in isoform 3. 1 PublicationAdd BLAST444

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M58297 mRNA Translation: AAA59898.1
AF055077 mRNA Translation: AAD55809.1
AF055078 mRNA Translation: AAD55810.1
AF161886 Genomic DNA Translation: AAF80465.1
AF161886 Genomic DNA Translation: AAF80466.1
AC016629 Genomic DNA No translation available.
AC016630 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72617.1
BC007777 mRNA Translation: AAH07777.1
BC053316 mRNA Translation: AAH53316.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12988.1 [P28698-1]
CCDS59427.1 [P28698-3]

Protein sequence database of the Protein Information Resource

More...PIRi		A40751

NCBI Reference Sequences

More...RefSeqi		NP_001253962.1, NM_001267033.1 [P28698-3]
NP_003413.2, NM_003422.2 [P28698-1]
NP_932172.1, NM_198055.1 [P28698-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000215057; ENSP00000215057; ENSG00000099326 [P28698-1]
ENST00000594234; ENSP00000469378; ENSG00000099326 [P28698-3]
ENST00000599369; ENSP00000469493; ENSG00000099326 [P28698-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7593

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7593

UCSC genome browser

More...UCSCi		uc002qtn.4 human [P28698-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58297 mRNA Translation: AAA59898.1
AF055077 mRNA Translation: AAD55809.1
AF055078 mRNA Translation: AAD55810.1
AF161886 Genomic DNA Translation: AAF80465.1
AF161886 Genomic DNA Translation: AAF80466.1
AC016629 Genomic DNA No translation available.
AC016630 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72617.1
BC007777 mRNA Translation: AAH07777.1
BC053316 mRNA Translation: AAH53316.1
CCDSiCCDS12988.1 [P28698-1]
CCDS59427.1 [P28698-3]
PIRiA40751
RefSeqiNP_001253962.1, NM_001267033.1 [P28698-3]
NP_003413.2, NM_003422.2 [P28698-1]
NP_932172.1, NM_198055.1 [P28698-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2FI2NMR-A/B37-128[»]
SMRiP28698
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi113419, 16 interactors
IntActiP28698, 5 interactors
STRINGi9606.ENSP00000215057

PTM databases

iPTMnetiP28698
PhosphoSitePlusiP28698

Polymorphism and mutation databases

BioMutaiMZF1
DMDMi215274121

Proteomic databases

jPOSTiP28698
MassIVEiP28698
MaxQBiP28698
PaxDbiP28698
PeptideAtlasiP28698
PRIDEiP28698
ProteomicsDBi54492 [P28698-1]
54493 [P28698-2]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P28698

The DNASU plasmid repository

More...DNASUi		7593

Genome annotation databases

EnsembliENST00000215057; ENSP00000215057; ENSG00000099326 [P28698-1]
ENST00000594234; ENSP00000469378; ENSG00000099326 [P28698-3]
ENST00000599369; ENSP00000469493; ENSG00000099326 [P28698-1]
GeneIDi7593
KEGGihsa:7593
UCSCiuc002qtn.4 human [P28698-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7593
DisGeNETi7593

GeneCards: human genes, protein and diseases

More...GeneCardsi		MZF1
HGNCiHGNC:13108 MZF1
HPAiHPA001757
MIMi194550 gene
neXtProtiNX_P28698
OpenTargetsiENSG00000099326
PharmGKBiPA37683

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00950000182890
HOGENOMiHOG000234619
InParanoidiP28698
KOiK09221
OMAiWHEEAGG
OrthoDBi1318335at2759
PhylomeDBiP28698
TreeFamiTF337913

Enzyme and pathway databases

SignaLinkiP28698
SIGNORiP28698

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MZF1 human
EvolutionaryTraceiP28698

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MZF1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7593
PharosiP28698

Protein Ontology

More...PROi		PR:P28698

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000099326 Expressed in 216 organ(s), highest expression level in right uterine tube
ExpressionAtlasiP28698 baseline and differential
GenevisibleiP28698 HS

Family and domain databases

CDDicd07936 SCAN, 1 hit
DisProtiDP02096
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 11 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 13 hits
SUPFAMiSSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 13 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMZF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P28698
Secondary accession number(s): M0QXU0
, Q7Z729, Q96I71, Q9NRY0, Q9UBW2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: November 25, 2008
Last modified: November 13, 2019
This is version 199 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again