Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Collagen alpha-1(II) chain

Gene

Col2a1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Type II collagen is specific for cartilaginous tissues. It is essential for the normal embryonic development of the skeleton, for linear growth and for the ability of cartilage to resist compressive forces.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi1301CalciumBy similarity1
Metal bindingi1303CalciumBy similarity1
Metal bindingi1304Calcium; via carbonyl oxygenBy similarity1
Metal bindingi1306Calcium; via carbonyl oxygenBy similarity1
Metal bindingi1309CalciumBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-1442490 Collagen degradation
R-MMU-1474244 Extracellular matrix organization
R-MMU-1650814 Collagen biosynthesis and modifying enzymes
R-MMU-186797 Signaling by PDGF
R-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-2022090 Assembly of collagen fibrils and other multimeric structures
R-MMU-216083 Integrin cell surface interactions
R-MMU-3000171 Non-integrin membrane-ECM interactions
R-MMU-3000178 ECM proteoglycans
R-MMU-419037 NCAM1 interactions
R-MMU-8874081 MET activates PTK2 signaling
R-MMU-8948216 Collagen chain trimerization

Names & Taxonomyi

Protein namesi
Recommended name:
Collagen alpha-1(II) chainBy similarity
Alternative name(s):
Alpha-1 type II collagenBy similarity
Cleaved into the following 2 chains:
Collagen alpha-1(II) chainBy similarity
ChondrocalcinBy similarity
Gene namesi
Name:Col2a1Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:88452 Col2a1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Involvement in diseasei

Defects in Col2a1 are the cause of a phenotype resembling human spondyloepiphyseal dysplasia congenita (sedc). Homozygous sedc mice can be identified at birth by their small size and shortened trunk. Adults have shortened noses, dysplastic vertebrae, femora and tibias, and retinoschisis and hearing loss.

Keywords - Diseasei

Disease mutation

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
PropeptideiPRO_000000573226 – 181N-terminal propeptideBy similarityAdd BLAST156
ChainiPRO_0000005733182 – 1241Collagen alpha-1(II) chainAdd BLAST1060
ChainiPRO_00000057341242 – 1487ChondrocalcinAdd BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1905-hydroxylysineBy similarity1
Glycosylationi190O-linked (Gal...) hydroxylysineBy similarity1
Modified residuei2875-hydroxylysineBy similarity1
Glycosylationi287O-linked (Gal...) hydroxylysineBy similarity1
Modified residuei2995-hydroxylysineBy similarity1
Glycosylationi299O-linked (Gal...) hydroxylysineBy similarity1
Modified residuei3085-hydroxylysineBy similarity1
Glycosylationi308O-linked (Gal...) hydroxylysineBy similarity1
Modified residuei3745-hydroxylysineBy similarity1
Glycosylationi374O-linked (Gal...) hydroxylysineBy similarity1
Modified residuei6085-hydroxylysineBy similarity1
Glycosylationi608O-linked (Gal...) hydroxylysineBy similarity1
Modified residuei6205-hydroxylysineBy similarity1
Glycosylationi620O-linked (Gal...) hydroxylysineBy similarity1
Modified residuei6594-hydroxyprolineBy similarity1
Modified residuei6684-hydroxyprolineBy similarity1
Modified residuei6703-hydroxyprolineBy similarity1
Modified residuei6714-hydroxyprolineBy similarity1
Modified residuei6744-hydroxyprolineBy similarity1
Modified residuei9073-hydroxyprolineBy similarity1
Modified residuei9084-hydroxyprolineBy similarity1
Modified residuei9144-hydroxyprolineBy similarity1
Modified residuei9204-hydroxyprolineBy similarity1
Modified residuei11443-hydroxyprolineBy similarity1
Modified residuei11814-hydroxyprolineBy similarity1
Modified residuei11863-hydroxyprolineBy similarity1
Modified residuei11874-hydroxyprolineBy similarity1
Modified residuei12013-hydroxyprolineBy similarity1
Modified residuei12024-hydroxyprolineBy similarity1
Modified residuei12054-hydroxyprolineBy similarity1
Modified residuei12073-hydroxyprolineBy similarity1
Modified residuei12084-hydroxyprolineBy similarity1
Modified residuei12114-hydroxyprolineBy similarity1
Modified residuei12133-hydroxyprolineBy similarity1
Modified residuei12144-hydroxyprolineBy similarity1
Disulfide bondi1283 ↔ 1315PROSITE-ProRule annotation
Disulfide bondi1289Interchain (with C-1306)PROSITE-ProRule annotation
Disulfide bondi1306Interchain (with C-1289)PROSITE-ProRule annotation
Disulfide bondi1323 ↔ 1485PROSITE-ProRule annotation
Disulfide bondi1393 ↔ 1438PROSITE-ProRule annotation

Post-translational modificationi

Contains mostly 4-hydroxyproline. Prolines at the third position of the tripeptide repeating unit (G-X-P) are 4-hydroxylated in some or all of the chains.By similarity
Contains 3-hydroxyproline at a few sites. This modification occurs on the first proline residue in the sequence motif Gly-Pro-Hyp, where Hyp is 4-hydroxyproline.By similarity
Lysine residues at the third position of the tripeptide repeating unit (G-X-Y) are 5-hydroxylated in some or all of the chains.By similarity
O-glycosylated on hydroxylated lysine residues. The O-linked glycan consists of a Glc-Gal disaccharide.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei181 – 182Cleavage; by procollagen N-endopeptidaseBy similarity2
Sitei1241 – 1242Cleavage; by procollagen C-endopeptidaseBy similarity2

Keywords - PTMi

Disulfide bond, Glycoprotein, Hydroxylation

Proteomic databases

PaxDbiP28481
PeptideAtlasiP28481
PRIDEiP28481

PTM databases

iPTMnetiP28481
PhosphoSitePlusiP28481

Expressioni

Developmental stagei

Expressed in chondrogenic tissues in advance of chondrocyte differentiation. Expressed early in embryogenesis at 9.5 days both in the cranial mesenchyme destined for the chondrocranium, and the sclerotome of the somites, and at 12.5 days in the primordia of the hyoid and the laryngeal cartilage. Detected in all the chondrogenic tissues of the axial and appendicular skeleton until the onset of endochondral ossification. Expression also observed in non-chondrogenic tissues such as the notochord. Also expressed much later in the tail tendon, at 16.5-18.5 days. Transiently expressed in the heart at 9.5-12.5 days, the epidermis at 10.5-14.5 days, the calvarial mesenchyme at 12.5-16.5 days, the inner ear at 14.5 days and the fetal brain from 9.5-14.5 days. Within the neural tube, expression is localized to the proliferative ventricular cells of the forebrain and midbrain of 9.5-10.5 day embryos, and subsequently, restricted to the rhombencephalic basal plate, the ventricular layer of the hindbrain and the cervical spinal cord.1 Publication

Gene expression databases

BgeeiENSMUSG00000022483 Expressed in 328 organ(s), highest expression level in cochlea
CleanExiMM_COL2A1
GenevisibleiP28481 MM

Interactioni

Subunit structurei

Homotrimers of alpha 1(II) chains.

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-738477,EBI-738477

GO - Molecular functioni

Protein-protein interaction databases

ComplexPortaliCPX-2957 Collagen type II trimer
CPX-2975 Collagen type XI trimer variant 1
IntActiP28481, 1 interactor
STRINGi10090.ENSMUSP00000023123

Structurei

3D structure databases

ProteinModelPortaliP28481
SMRiP28481
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP28481

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini32 – 89VWFCPROSITE-ProRule annotationAdd BLAST58
Domaini1253 – 1487Fibrillar collagen NC1PROSITE-ProRule annotationAdd BLAST235

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni201 – 1214Triple-helical regionAdd BLAST1014
Regioni1215 – 1241Nonhelical region (C-terminal)Add BLAST27

Domaini

The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function (By similarity).By similarity

Sequence similaritiesi

Belongs to the fibrillar collagen family.PROSITE-ProRule annotation

Keywords - Domaini

Collagen, Repeat, Signal

Phylogenomic databases

eggNOGiKOG3544 Eukaryota
ENOG410ZVV2 LUCA
GeneTreeiENSGT00900000140789
HOVERGENiHBG004933
InParanoidiP28481
KOiK19719
OMAiVQKAGSC
OrthoDBiEOG091G03LV
PhylomeDBiP28481
TreeFamiTF344135

Family and domain databases

InterProiView protein in InterPro
IPR008160 Collagen
IPR000885 Fib_collagen_C
IPR001007 VWF_dom
PfamiView protein in Pfam
PF01410 COLFI, 1 hit
PF01391 Collagen, 10 hits
PF00093 VWC, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD002078 Fib_collagen_C, 1 hit
SMARTiView protein in SMART
SM00038 COLFI, 1 hit
SM00214 VWC, 1 hit
PROSITEiView protein in PROSITE
PS51461 NC1_FIB, 1 hit
PS01208 VWFC_1, 1 hit
PS50184 VWFC_2, 1 hit

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P28481-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIRLGAPQSL VLLTLLIAAV LRCQGQDAQE AGSCLQNGQR YKDKDVWKPS
60 70 80 90 100
SCRICVCDTG NVLCDDIICE DPDCLNPEIP FGECCPICPA DLATASGKLG
110 120 130 140 150
PKGQKGEPGD IRDIIGPRGP PGPQGPAGEQ GPRGDRGDKG EKGAPGPRGR
160 170 180 190 200
DGEPGTPGNP GPAGPPGPPG PPGLSAGNFA AQMAGGYDEK AGGAQMGVMQ
210 220 230 240 250
GPMGPMGPRG PPGPAGAPGP QGFQGNPGEP GEPGVSGPMG PRGPPGPAGK
260 270 280 290 300
PGDDGEAGKP GKSGERGLPG PQGARGFPGT PGLPGVKGHR GYPGLDGAKG
310 320 330 340 350
EAGAPGVKGE SGSPGENGSP GPMGPRGLPG ERGRTGPAGA AGARGNDGQP
360 370 380 390 400
GPAGPPGPVG PAGGPGFPGA PGAKGEAGPT GARGPEGAQG SRGEPGNPGS
410 420 430 440 450
PGPAGASGNP GTDGIPGAKG SAGAPGIAGA PGFPGPRGPP GPQGATGPLG
460 470 480 490 500
PKGQAGEPGI AGFKGDQGPK GETGPAGPQG APGPAGEEGK RGARGEPGGA
510 520 530 540 550
GPIGPPGERG APGNRGFPGQ DGLAGPKGAP GERGPSGLTG PKGANGDPGR
560 570 580 590 600
PGEPGLPGAR GLTGRPGDAG PQGKVGPSGA PGEDGRPGPP GPQGARGQPG
610 620 630 640 650
VMGFPGPKGA NGEPGKAGEK GLAGAPGLRG LPGKDGETGA AGPPGPSGPA
660 670 680 690 700
GERGEQGAPG PSGFQGLPGP PGPPGEGGKQ GDQGIPGEAG APGLVGPRGE
710 720 730 740 750
RGFPGERGSP GAQGLQGPRG LPGTPGTDGP KGAAGPDGPP GAQGPPGLQG
760 770 780 790 800
MPGERGAAGI AGPKGDRGDV GEKGPEGAPG KDGGRGLTGP IGPPGPAGAN
810 820 830 840 850
GEKGEVGPPG PSGSTGARGA PGERGETGPP GPAGFAGPPG ADGQPGAKGD
860 870 880 890 900
QGEAGQKGDA GAPGPQGPSG APGPQGPTGV TGPKGARGAQ GPPGATGFPG
910 920 930 940 950
AAGRVGPPGA NGNPGPAGPP GPAGKDGPKG VRGDSGPPGR AGDPGLQGPA
960 970 980 990 1000
GAPGEKGEPG DDGPSGLDGP PGPQGLAGQR GIVGLPGQRG ERGFPGLPGP
1010 1020 1030 1040 1050
SGEPGKQGAP GASGDRGPPG PVGPPGLTGP AGEPGREGSP GADGPPGRDG
1060 1070 1080 1090 1100
AAGVKGDRGE TGALGAPGAP GPPGSPGPAG PTGKQGDRGE AGAQGPMGPS
1110 1120 1130 1140 1150
GPAGARGIAG PQGPRGDKGE SGEQGERGLK GHRGFTGLQG LPGPPGPSGD
1160 1170 1180 1190 1200
QGASGPAGPS GPRGPPGPVG PSGKDGSNGI PGPIGPPGPR GRSGETGPVG
1210 1220 1230 1240 1250
PPGSPGPPGP PGPPGPGIDM SAFAGLGQRE KGPDPMQYMR ADEADSTLRQ
1260 1270 1280 1290 1300
HDVEVDATLK SLNNQIESIR SPDGSRKNPA RTCQDLKLCH PEWKSGDYWI
1310 1320 1330 1340 1350
DPNQGCTLDA MKVFCNMETG ETCVYPNPAT VPRKNWWSSK SKEKKHIWFG
1360 1370 1380 1390 1400
ETMNGGFHFS YGDGNLAPNT ANVQMTFLRL LSTEGSQNIT YHCKNSIAYL
1410 1420 1430 1440 1450
DEAAGNLKKA LLIQGSNDVE MRAEGNSRFT YTALKDGCTK HTGKWGKTVI
1460 1470 1480
EYRSQKTSRL PIIDIAPMDI GGAEQEFGVD IGPVCFL
Note: No experimental confirmation available.
Length:1,487
Mass (Da):141,973
Last modified:February 6, 2007 - v2
Checksum:iE52A7F3951C76701
GO
Isoform 2 (identifier: P28481-1) [UniParc]FASTAAdd to basket
Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     114-142: Missing.

Show »
Length:1,458
Mass (Da):139,110
Checksum:i5B28FCBC6BFB3A95
GO
Isoform 3 (identifier: P28481-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     29-97: QEAGSCLQNGQRYKDKDVWKPSSCRICVCDTGNVLCDDIICEDPDCLNPEIPFGECCPICPADLATASG → R
     114-142: Missing.

Show »
Length:1,390
Mass (Da):131,859
Checksum:i514E8A3086208F1B
GO
Isoform 4 (identifier: P28481-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-113: Missing.
     125-142: Missing.

Show »
Length:1,458
Mass (Da):139,027
Checksum:i0D7D97A4DD9E1540
GO
Isoform 5 (identifier: P28481-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     114-124: Missing.
     143-177: Missing.

Show »
Length:1,441
Mass (Da):137,868
Checksum:i88086B838B2876F9
GO
Isoform 6 (identifier: P28481-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-113: Missing.
     143-177: Missing.

Show »
Length:1,441
Mass (Da):137,785
Checksum:iAB4C30D6A44C5DDE
GO
Isoform 7 (identifier: P28481-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-97: QEAGSCLQNGQRYKDKDVWKPSSCRICVCDTGNVLCDDIICEDPDCLNPEIPFGECCPICPADLATASG → R

Note: No experimental confirmation available.
Show »
Length:1,419
Mass (Da):134,722
Checksum:iF0173B07E7C72D5C
GO

Sequence cautioni

The sequence BAC25865 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti97G → GR in AAA68100 (PubMed:1885613).Curated1
Sequence conflicti97G → GR in AAA68101 (PubMed:1885613).Curated1
Sequence conflicti97G → GR in AAA68099 (PubMed:1885613).Curated1
Sequence conflicti97G → GR in AAA68102 (PubMed:1885613).Curated1
Sequence conflicti272Q → M in AAA68100 (PubMed:1885613).Curated1
Sequence conflicti272Q → M in AAA68101 (PubMed:1885613).Curated1
Sequence conflicti272Q → M in AAA68099 (PubMed:1885613).Curated1
Sequence conflicti272Q → M in AAA68102 (PubMed:1885613).Curated1
Sequence conflicti539T → A in AAA68100 (PubMed:1885613).Curated1
Sequence conflicti539T → A in AAA68101 (PubMed:1885613).Curated1
Sequence conflicti539T → A in AAA68099 (PubMed:1885613).Curated1
Sequence conflicti539T → A in AAA68102 (PubMed:1885613).Curated1
Sequence conflicti806V → A in AAA68100 (PubMed:1885613).Curated1
Sequence conflicti806V → A in AAA68101 (PubMed:1885613).Curated1
Sequence conflicti806V → A in AAA68099 (PubMed:1885613).Curated1
Sequence conflicti806V → A in AAA68102 (PubMed:1885613).Curated1
Sequence conflicti824R → P in AAA68100 (PubMed:1885613).Curated1
Sequence conflicti824R → P in AAA68101 (PubMed:1885613).Curated1
Sequence conflicti824R → P in AAA68099 (PubMed:1885613).Curated1
Sequence conflicti947Q → E in AAA68100 (PubMed:1885613).Curated1
Sequence conflicti947Q → E in AAA68101 (PubMed:1885613).Curated1
Sequence conflicti947Q → E in AAA68099 (PubMed:1885613).Curated1
Sequence conflicti947Q → E in AAA68102 (PubMed:1885613).Curated1
Sequence conflicti1119G → R in AAH51383 (PubMed:15489334).Curated1
Sequence conflicti1141 – 1145LPGPP → SAWPS in AAC06113 (PubMed:1797232).Curated5

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti989R → C in sedc mice. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02278029 – 97QEAGS…ATASG → R in isoform 3 and isoform 7. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_022781103 – 113Missing in isoform 4 and isoform 6. CuratedAdd BLAST11
Alternative sequenceiVSP_022782114 – 142Missing in isoform 2 and isoform 3. CuratedAdd BLAST29
Alternative sequenceiVSP_022783114 – 124Missing in isoform 5. CuratedAdd BLAST11
Alternative sequenceiVSP_022784125 – 142Missing in isoform 4. CuratedAdd BLAST18
Alternative sequenceiVSP_022785143 – 177Missing in isoform 5 and isoform 6. CuratedAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M65161 Genomic DNA Translation: AAA68099.1
M65161 Genomic DNA Translation: AAA68100.1
M65161 Genomic DNA Translation: AAA68101.1
M65161 Genomic DNA Translation: AAA68102.1
BC030913 mRNA Translation: AAH30913.1
BC051383 mRNA Translation: AAH51383.1
BC052326 mRNA Translation: AAH52326.1
BC082331 mRNA Translation: AAH82331.1
S63190 Genomic DNA Translation: AAB19627.1
M63708 Genomic DNA Translation: AAA37436.1
M63709 Genomic DNA Translation: AAC06113.1
M63710 Genomic DNA Translation: AAA37435.1
AK028295 mRNA Translation: BAC25865.1 Different initiation.
X57982 Genomic DNA Translation: CAA41047.1
CCDSiCCDS37189.2 [P28481-3]
CCDS49716.1 [P28481-7]
PIRiA41182
B41182
RefSeqiNP_001106987.2, NM_001113515.2 [P28481-7]
NP_112440.2, NM_031163.3 [P28481-3]
UniGeneiMm.2423

Genome annotation databases

EnsembliENSMUST00000023123; ENSMUSP00000023123; ENSMUSG00000022483 [P28481-3]
ENSMUST00000088355; ENSMUSP00000085693; ENSMUSG00000022483 [P28481-7]
GeneIDi12824
KEGGimmu:12824
UCSCiuc007xlp.2 mouse [P28481-3]
uc007xlq.2 mouse [P28481-7]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M65161 Genomic DNA Translation: AAA68099.1
M65161 Genomic DNA Translation: AAA68100.1
M65161 Genomic DNA Translation: AAA68101.1
M65161 Genomic DNA Translation: AAA68102.1
BC030913 mRNA Translation: AAH30913.1
BC051383 mRNA Translation: AAH51383.1
BC052326 mRNA Translation: AAH52326.1
BC082331 mRNA Translation: AAH82331.1
S63190 Genomic DNA Translation: AAB19627.1
M63708 Genomic DNA Translation: AAA37436.1
M63709 Genomic DNA Translation: AAC06113.1
M63710 Genomic DNA Translation: AAA37435.1
AK028295 mRNA Translation: BAC25865.1 Different initiation.
X57982 Genomic DNA Translation: CAA41047.1
CCDSiCCDS37189.2 [P28481-3]
CCDS49716.1 [P28481-7]
PIRiA41182
B41182
RefSeqiNP_001106987.2, NM_001113515.2 [P28481-7]
NP_112440.2, NM_031163.3 [P28481-3]
UniGeneiMm.2423

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2W65X-ray2.21E530-538[»]
4BKLX-ray3.25E/F/G744-780[»]
5MU0X-ray2.70Q/R/S/T/U/V/W/X555-571[»]
5MUBX-ray3.10E/H/K/N/Q/T/W/X546-577[»]
5MV3X-ray2.95E/H/K/N/Q/T/W/X1179-1208[»]
5MV4X-ray2.90E/H/K/N/Q/T/W/X792-846[»]
ProteinModelPortaliP28481
SMRiP28481
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

ComplexPortaliCPX-2957 Collagen type II trimer
CPX-2975 Collagen type XI trimer variant 1
IntActiP28481, 1 interactor
STRINGi10090.ENSMUSP00000023123

PTM databases

iPTMnetiP28481
PhosphoSitePlusiP28481

Proteomic databases

PaxDbiP28481
PeptideAtlasiP28481
PRIDEiP28481

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023123; ENSMUSP00000023123; ENSMUSG00000022483 [P28481-3]
ENSMUST00000088355; ENSMUSP00000085693; ENSMUSG00000022483 [P28481-7]
GeneIDi12824
KEGGimmu:12824
UCSCiuc007xlp.2 mouse [P28481-3]
uc007xlq.2 mouse [P28481-7]

Organism-specific databases

CTDi1280
MGIiMGI:88452 Col2a1

Phylogenomic databases

eggNOGiKOG3544 Eukaryota
ENOG410ZVV2 LUCA
GeneTreeiENSGT00900000140789
HOVERGENiHBG004933
InParanoidiP28481
KOiK19719
OMAiVQKAGSC
OrthoDBiEOG091G03LV
PhylomeDBiP28481
TreeFamiTF344135

Enzyme and pathway databases

ReactomeiR-MMU-1442490 Collagen degradation
R-MMU-1474244 Extracellular matrix organization
R-MMU-1650814 Collagen biosynthesis and modifying enzymes
R-MMU-186797 Signaling by PDGF
R-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-2022090 Assembly of collagen fibrils and other multimeric structures
R-MMU-216083 Integrin cell surface interactions
R-MMU-3000171 Non-integrin membrane-ECM interactions
R-MMU-3000178 ECM proteoglycans
R-MMU-419037 NCAM1 interactions
R-MMU-8874081 MET activates PTK2 signaling
R-MMU-8948216 Collagen chain trimerization

Miscellaneous databases

ChiTaRSiCol2a1 mouse
EvolutionaryTraceiP28481
PROiPR:P28481
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022483 Expressed in 328 organ(s), highest expression level in cochlea
CleanExiMM_COL2A1
GenevisibleiP28481 MM

Family and domain databases

InterProiView protein in InterPro
IPR008160 Collagen
IPR000885 Fib_collagen_C
IPR001007 VWF_dom
PfamiView protein in Pfam
PF01410 COLFI, 1 hit
PF01391 Collagen, 10 hits
PF00093 VWC, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD002078 Fib_collagen_C, 1 hit
SMARTiView protein in SMART
SM00038 COLFI, 1 hit
SM00214 VWC, 1 hit
PROSITEiView protein in PROSITE
PS51461 NC1_FIB, 1 hit
PS01208 VWFC_1, 1 hit
PS50184 VWFC_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCO2A1_MOUSE
AccessioniPrimary (citable) accession number: P28481
Secondary accession number(s): Q61428
, Q62031, Q62032, Q62033, Q641K3, Q6LDB1, Q6LDI8, Q6LDI9, Q80VY3, Q80X38, Q8CEF7, Q8K0N6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: February 6, 2007
Last modified: November 7, 2018
This is version 180 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again