Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 203 (29 Sep 2021)
Sequence version 4 (10 Feb 2021)
Previous versions | rss
Add a publicationFeedback
Protein

Serine/threonine-protein kinase B-raf

Gene

Braf

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Phosphorylates MAP2K1, and thereby activates the MAP kinase signal transduction pathway. May play a role in the postsynaptic responses of hippocampal neurons.

By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+CuratedNote: Binds 2 Zn2+ ions per subunit.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

In quiescent cells, maintained in an inactive state via an intramolecular interaction between the protein kinase and N-terminal domains. Following mitogen-mediated cell activation, binds via its RGB domain to active HRAS (GTP-bound) which releases the inhibitory intramolecular interaction between the two domains. This allows the MAP2K1-mediated dimerization of KSR1 or KSR2, and BRAF which activates BRAF.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi219Zinc 1By similarity1
Metal bindingi232Zinc 2By similarity1
Metal bindingi235Zinc 2By similarity1
Metal bindingi245Zinc 1By similarity1
Metal bindingi248Zinc 1By similarity1
Metal bindingi253Zinc 2By similarity1
Metal bindingi256Zinc 2By similarity1
Metal bindingi264Zinc 1By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei468ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei561Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi448 – 456ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAllosteric enzyme, Kinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1295596, Spry regulation of FGF signaling
R-MMU-170968, Frs2-mediated activation
R-MMU-5673000, RAF activation
R-MMU-5674135, MAP2K and MAPK activation
R-MMU-5674499, Negative feedback regulation of MAPK pathway
R-MMU-5675221, Negative regulation of MAPK pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase B-rafCurated (EC:2.7.11.1By similarity)
Alternative name(s):
Proto-oncogene B-Raf
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BrafImported
Synonyms:B-raf
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:88190, Braf

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000002413

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Participates in a chromosomal translocation that produces a Tif1a-BRAF (T18) oncogene originally isolated from a furfural-induced hepatoma.

Keywords - Diseasei

Proto-oncogene

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2331061

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000856662 – 751Serine/threonine-protein kinase B-rafAdd BLAST750

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei135PhosphoserineBy similarity1
Modified residuei316PhosphoserineCombined sources1
Modified residuei348PhosphoserineCombined sources1
Modified residuei356Phosphothreonine; by autocatalysisBy similarity1
Modified residuei379PhosphothreonineBy similarity1
Modified residuei382PhosphoserineBy similarity1
Modified residuei384PhosphothreonineBy similarity1
Modified residuei431PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki563Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei656Omega-N-methylarginine; by PRMT5By similarity1
Modified residuei714PhosphoserineBy similarity1
Modified residuei735PhosphoserineCombined sources1
Modified residuei738Phosphothreonine; by MAPK1By similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-348 by SGK1 inhibits its activity.By similarity
Methylation by PRMT5 decreases stability and kinase activity.1 Publication
Ubiquitinated by RNF149; which leads to proteasomal degradation. Polyubiquitinated at Lys-615 in response to EGF (By similarity).By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P28028

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P28028

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P28028

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P28028

PeptideAtlas

More...
PeptideAtlasi
P28028

PRoteomics IDEntifications database

More...
PRIDEi
P28028

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
273625 [P28028-3]
320910

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P28028

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P28028

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P28028

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000002413, Expressed in pineal body and 273 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P28028, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P28028, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Homodimer. Heterodimerizes with RAF1, and the heterodimer possesses a highly increased kinase activity compared to the respective homodimers or monomers. Heterodimerization is mitogen-regulated and enhanced by 14-3-3 proteins. MAPK1/ERK2 activation can induce a negative feedback that promotes the dissociation of the heterodimer by phosphorylating BRAF at Thr-738. Heterodimerizes (via N-terminus) with KSR1 (via N-terminus) or KSR2 (via N-terminus) in a MAP2K1-dependent manner (By similarity).

Interacts with MAP2K1 and MAP2K2 (By similarity).

Found in a complex with at least BRAF, HRAS, MAP2K1, MAPK3 and RGS14.

Interacts with RIT1.

Interacts (via N-terminus) with RGS14 (via RBD domains); the interaction mediates the formation of a ternary complex with RAF1, a ternary complex inhibited by GNAI1 (By similarity).

Interacts with DGKH (By similarity).

Interacts with PRMT5 (By similarity).

Interacts with AKAP13, MAP2K1 and KSR1.

Identified in a complex with AKAP13, KSR1 and MAP2K1 (PubMed:21102438).

Interacts with FNIP1 and FNIP2 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
225124, 77 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P28028

Database of interacting proteins

More...
DIPi
DIP-57050N

Protein interaction database and analysis system

More...
IntActi
P28028, 10 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000002487

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P28028

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P28028, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
P28028

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini139 – 211RBDPROSITE-ProRule annotationAdd BLAST73
Domaini442 – 702Protein kinasePROSITE-ProRule annotationAdd BLAST261

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 55DisorderedSequence analysisAdd BLAST55
Regioni288 – 440DisorderedSequence analysisAdd BLAST153

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi293 – 320Polar residuesSequence analysisAdd BLAST28
Compositional biasi375 – 411Polar residuesSequence analysisAdd BLAST37
Compositional biasi412 – 436Basic and acidic residuesSequence analysisAdd BLAST25

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0193, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156154

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_023684_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P28028

Identification of Orthologs from Complete Genome Data

More...
OMAi
VRFNVSS

Database of Orthologous Groups

More...
OrthoDBi
243095at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P28028

TreeFam database of animal gene trees

More...
TreeFami
TF317006

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00029, C1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020454, DAG/PE-bd
IPR011009, Kinase-like_dom_sf
IPR002219, PE/DAG-bd
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR003116, RBD_dom
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008271, Ser/Thr_kinase_AS
IPR029071, Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00130, C1_1, 1 hit
PF07714, PK_Tyr_Ser-Thr, 1 hit
PF02196, RBD, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00008, DAGPEDOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00109, C1, 1 hit
SM00455, RBD, 1 hit
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54236, SSF54236, 1 hit
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit
PS50898, RBD, 1 hit
PS00479, ZF_DAG_PE_1, 1 hit
PS50081, ZF_DAG_PE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 3 (identifier: P28028-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALSGGGGS SSGGGGGGGG GGGGGDGGGG AEQGQALFNG DMEPEAGAGA
60 70 80 90 100
AASSAADPAI PEEVWNIKQM IKLTQEHIEA LLDKFGGEHN PPSIYLEAYE
110 120 130 140 150
EYTSKLDALQ QREQQLLESL VFQTPTDASR NNPKSPQKPI VRVFLPNKQR
160 170 180 190 200
TVVPARCGVT VRDSLKKALM MRGLIPECCA VYRIQDGEKK PIGWDTDISW
210 220 230 240 250
LTGEELHVEV LENVPLTTHN FVRKTFFTLA FCDFCRKLLF QGFRCQTCGY
260 270 280 290 300
KFHQRCSTEV PLMCVNYDQL DLLFVSKFFE HHPVPQEEAS FPETALPSGS
310 320 330 340 350
SSAPPSDSTG PQILTSPSPS KSIPIPQPFR PADEDHRNQF GQRDRSSSAP
360 370 380 390 400
NVHINTIEPV NIDDLIRDQG FRGDGGSTTG LSATPPASLP GSLTNVKALQ
410 420 430 440 450
KSPGPQRERK SSSSSSSEDR SRMKTLGRRD SSDDWEIPDG QITVGQRIGS
460 470 480 490 500
GSFGTVYKGK WHGDVAVKML NVTAPTPQQL QAFKNEVGVL RKTRHVNILL
510 520 530 540 550
FMGYSTKPQL AIVTQWCEGS SLYHHLHIIE TKFEMIKLID IARQTAQGMD
560 570 580 590 600
YLHAKSIIHR DLKSNNIFLH EDLTVKIGDF GLATVKSRWS GSHQFEQLSG
610 620 630 640 650
SILWMAPEVI RMQDKNPYSF QSDVYAFGIV LYELMTGQLP YSNINNRDQI
660 670 680 690 700
IFMVGRGYLS PDLSKVRSNC PKAMKRLMAE CLKKKRDERP LFPQILASIE
710 720 730 740 750
LLARSLPKIH RSASEPSLNR AGFQTEDFSL YACASPKTPI QAGGYGGFPV

H
Length:751
Mass (Da):82,515
Last modified:February 10, 2021 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0643D7F6C44A9A05
GO
Isoform 1 (identifier: P28028-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-363: D → DEKFPEVELQDQR
     375-375: G → GAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFEPGPVFR
     747-751: GFPVH → EFAAFK

Show »
Length:804
Mass (Da):88,780
Checksum:i4C6CC16A2C660A17
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A7N4FLU7A0A7N4FLU7_MOUSE
Serine/threonine-protein kinase B-r...
Braf
750Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA37320 differs from that shown. Chimeric cDNA.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti10 – 11SS → RR in BAE24384 (PubMed:16141072).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_060878363D → DEKFPEVELQDQR in isoform 1. 1
Alternative sequenceiVSP_060879375G → GAPLNQLMRCLRKYQSRTPS PLLHSVPSEIVFDFEPGPVF R in isoform 1. 1
Alternative sequenceiVSP_060880747 – 751GFPVH → EFAAFK in isoform 1. 5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK140431 mRNA Translation: BAE24384.1
AC122345 Genomic DNA No translation available.
AC163109 Genomic DNA No translation available.
M64429 mRNA Translation: AAA37320.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39463.1 [P28028-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A40951, TVMSBF

NCBI Reference Sequences

More...
RefSeqi
NP_647455.3, NM_139294.5 [P28028-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000002487; ENSMUSP00000002487; ENSMUSG00000002413 [P28028-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
109880

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:109880

UCSC genome browser

More...
UCSCi
uc009bme.2, mouse [P28028-3]
uc009bmg.1, mouse

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK140431 mRNA Translation: BAE24384.1
AC122345 Genomic DNA No translation available.
AC163109 Genomic DNA No translation available.
M64429 mRNA Translation: AAA37320.1 Sequence problems.
CCDSiCCDS39463.1 [P28028-1]
PIRiA40951, TVMSBF
RefSeqiNP_647455.3, NM_139294.5 [P28028-1]

3D structure databases

BMRBiP28028
ModBaseiSearch...
SWISS-MODEL-WorkspaceiSubmit a new modelling project...

Protein-protein interaction databases

BioGRIDi225124, 77 interactors
CORUMiP28028
DIPiDIP-57050N
IntActiP28028, 10 interactors
STRINGi10090.ENSMUSP00000002487

Chemistry databases

BindingDBiP28028
ChEMBLiCHEMBL2331061

PTM databases

iPTMnetiP28028
PhosphoSitePlusiP28028
SwissPalmiP28028

Proteomic databases

EPDiP28028
jPOSTiP28028
MaxQBiP28028
PaxDbiP28028
PeptideAtlasiP28028
PRIDEiP28028
ProteomicsDBi273625 [P28028-3]
320910

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
751, 2237 antibodies

The DNASU plasmid repository

More...
DNASUi
109880

Genome annotation databases

EnsembliENSMUST00000002487; ENSMUSP00000002487; ENSMUSG00000002413 [P28028-1]
GeneIDi109880
KEGGimmu:109880
UCSCiuc009bme.2, mouse [P28028-3]
uc009bmg.1, mouse

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
673
MGIiMGI:88190, Braf
VEuPathDBiHostDB:ENSMUSG00000002413

Phylogenomic databases

eggNOGiKOG0193, Eukaryota
GeneTreeiENSGT00940000156154
HOGENOMiCLU_023684_1_0_1
InParanoidiP28028
OMAiVRFNVSS
OrthoDBi243095at2759
PhylomeDBiP28028
TreeFamiTF317006

Enzyme and pathway databases

ReactomeiR-MMU-1295596, Spry regulation of FGF signaling
R-MMU-170968, Frs2-mediated activation
R-MMU-5673000, RAF activation
R-MMU-5674135, MAP2K and MAPK activation
R-MMU-5674499, Negative feedback regulation of MAPK pathway
R-MMU-5675221, Negative regulation of MAPK pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
109880, 2 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Braf, mouse

Protein Ontology

More...
PROi
PR:P28028
RNActiP28028, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000002413, Expressed in pineal body and 273 other tissues
ExpressionAtlasiP28028, baseline and differential
GenevisibleiP28028, MM

Family and domain databases

CDDicd00029, C1, 1 hit
InterProiView protein in InterPro
IPR020454, DAG/PE-bd
IPR011009, Kinase-like_dom_sf
IPR002219, PE/DAG-bd
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR003116, RBD_dom
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008271, Ser/Thr_kinase_AS
IPR029071, Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00130, C1_1, 1 hit
PF07714, PK_Tyr_Ser-Thr, 1 hit
PF02196, RBD, 1 hit
PRINTSiPR00008, DAGPEDOMAIN
SMARTiView protein in SMART
SM00109, C1, 1 hit
SM00455, RBD, 1 hit
SM00220, S_TKc, 1 hit
SUPFAMiSSF54236, SSF54236, 1 hit
SSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit
PS50898, RBD, 1 hit
PS00479, ZF_DAG_PE_1, 1 hit
PS50081, ZF_DAG_PE_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBRAF_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P28028
Secondary accession number(s): E9QNG9, F6SZ47, Q3USE9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 10, 2021
Last modified: September 29, 2021
This is version 203 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again