Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 244 (07 Oct 2020)
Sequence version 2 (28 Nov 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Phosphatidylinositol 3-kinase regulatory subunit alpha

Gene

PIK3R1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues. Plays an important role in signaling in response to FGFR1, FGFR2, FGFR3, FGFR4, KITLG/SCF, KIT, PDGFRA and PDGFRB. Likewise, plays a role in ITGB2 signaling (PubMed:17626883, PubMed:19805105, PubMed:7518429). Modulates the cellular response to ER stress by promoting nuclear translocation of XBP1 isoform 2 in a ER stress- and/or insulin-dependent manner during metabolic overloading in the liver and hence plays a role in glucose tolerance improvement (PubMed:20348923).4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processHost-virus interaction, Protein transport, Stress response, Transport

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:ENSG00000145675-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.153, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P27986

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-109704, PI3K Cascade
R-HSA-112399, IRS-mediated signalling
R-HSA-114604, GPVI-mediated activation cascade
R-HSA-1236382, Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
R-HSA-1250342, PI3K events in ERBB4 signaling
R-HSA-1257604, PIP3 activates AKT signaling
R-HSA-1266695, Interleukin-7 signaling
R-HSA-1433557, Signaling by SCF-KIT
R-HSA-1660499, Synthesis of PIPs at the plasma membrane
R-HSA-180292, GAB1 signalosome
R-HSA-1839117, Signaling by cytosolic FGFR1 fusion mutants
R-HSA-186763, Downstream signal transduction
R-HSA-1963642, PI3K events in ERBB2 signaling
R-HSA-198203, PI3K/AKT activation
R-HSA-202424, Downstream TCR signaling
R-HSA-2029485, Role of phospholipids in phagocytosis
R-HSA-210993, Tie2 Signaling
R-HSA-2219530, Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-2424491, DAP12 signaling
R-HSA-2730905, Role of LAT2/NTAL/LAB on calcium mobilization
R-HSA-373753, Nephrin family interactions
R-HSA-388841, Costimulation by the CD28 family
R-HSA-389357, CD28 dependent PI3K/Akt signaling
R-HSA-416476, G alpha (q) signalling events
R-HSA-430116, GP1b-IX-V activation signalling
R-HSA-4420097, VEGFA-VEGFR2 Pathway
R-HSA-512988, Interleukin-3, Interleukin-5 and GM-CSF signaling
R-HSA-5637810, Constitutive Signaling by EGFRvIII
R-HSA-5654689, PI-3K cascade:FGFR1
R-HSA-5654695, PI-3K cascade:FGFR2
R-HSA-5654710, PI-3K cascade:FGFR3
R-HSA-5654720, PI-3K cascade:FGFR4
R-HSA-5655253, Signaling by FGFR2 in disease
R-HSA-5655291, Signaling by FGFR4 in disease
R-HSA-5655302, Signaling by FGFR1 in disease
R-HSA-6785807, Interleukin-4 and Interleukin-13 signaling
R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8851907, MET activates PI3K/AKT signaling
R-HSA-8853334, Signaling by FGFR3 fusions in cancer
R-HSA-8853338, Signaling by FGFR3 point mutants in cancer
R-HSA-8853659, RET signaling
R-HSA-9009391, Extra-nuclear estrogen signaling
R-HSA-9027276, Erythropoietin activates Phosphoinositide-3-kinase (PI3K)
R-HSA-9028335, Activated NTRK2 signals through PI3K
R-HSA-912526, Interleukin receptor SHC signaling
R-HSA-912631, Regulation of signaling by CBL
R-HSA-9603381, Activated NTRK3 signals through PI3K
R-HSA-9607240, FLT3 Signaling
R-HSA-9664565, Signaling by ERBB2 KD Mutants
R-HSA-9665348, Signaling by ERBB2 ECD mutants
R-HSA-9673767, Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants
R-HSA-9673770, Signaling by PDGFRA extracellular domain mutants
R-HSA-983695, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P27986

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P27986

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
P27986, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylinositol 3-kinase regulatory subunit alpha
Short name:
PI3-kinase regulatory subunit alpha
Short name:
PI3K regulatory subunit alpha
Short name:
PtdIns-3-kinase regulatory subunit alpha
Alternative name(s):
Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha
Short name:
PI3-kinase subunit p85-alpha
Short name:
PtdIns-3-kinase regulatory subunit p85-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PIK3R1
Synonyms:GRB1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000145675.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8979, PIK3R1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
171833, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P27986

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Agammaglobulinemia 7, autosomal recessive (AGM7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life.
Related information in OMIM
SHORT syndrome (SHORTS)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare, multisystem disease characterized by short stature, anomalies of the anterior chamber of the eye, characteristic facial features such as triangular facies, lack of facial fat, and hypoplastic nasal alae with overhanging columella, partial lipodystrophy, hernias, hyperextensibility, and delayed dentition. The clinical phenotype can include insulin resistance, nephrocalcinosis, and hearing deficits. Developmental milestones and cognition are normal.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_070221489E → K in SHORTS; there is 70 to 90% reduction in the effect of insulin on AKT1 activation, glycogen synthesis and glucose uptake, indicating severe insulin resistance for both proximal and distal PI3K-dependent signaling. 1 PublicationCorresponds to variant dbSNP:rs397514047EnsemblClinVar.1
Natural variantiVAR_070222539Missing in SHORTS; there is 70 to 90% reduction in the effect of insulin on AKT1 activation, glycogen synthesis and glucose uptake, indicating severe insulin resistance for both proximal and distal PI3K-dependent signaling. 1 Publication1
Natural variantiVAR_070223649R → W in SHORTS; impairs interaction between PIK3R1 and IRS1 and reduces AKT1-mediated insulin signaling. 2 PublicationsCorresponds to variant dbSNP:rs397515453EnsemblClinVar.1
Immunodeficiency 36 (IMD36)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency characterized by impaired B-cell function, hypogammaglobulinemia and recurrent infections.
Related information in OMIM

Keywords - Diseasei

Disease mutation, Dwarfism

Organism-specific databases

DisGeNET

More...
DisGeNETi
5295

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
PIK3R1

MalaCards human disease database

More...
MalaCardsi
PIK3R1
MIMi269880, phenotype
615214, phenotype
616005, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000145675

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
397596, Activated PI3K-delta syndrome
33110, Autosomal agammaglobulinemia
3163, SHORT syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33312

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P27986, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2506

Drug and drug target database

More...
DrugBanki
DB06486, Enzastaurin
DB01064, Isoprenaline
DB05210, SF1126
DB08059, Wortmannin

DrugCentral

More...
DrugCentrali
P27986

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PIK3R1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
118572681

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000807582 – 724Phosphatidylinositol 3-kinase regulatory subunit alphaAdd BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei154PhosphoserineCombined sources1
Modified residuei279PhosphoserineCombined sources1
Modified residuei467PhosphotyrosineBy similarity1
Modified residuei580PhosphotyrosineCombined sources1
Modified residuei608PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Polyubiquitinated in T-cells by CBLB; which does not promote proteasomal degradation but impairs association with CD28 and CD3Z upon T-cell activation.2 Publications
Phosphorylated. Tyrosine phosphorylated in response to signaling by FGFR1, FGFR2, FGFR3 and FGFR4. Phosphorylated by CSF1R. Phosphorylated by ERBB4. Phosphorylated on tyrosine residues by TEK/TIE2. Dephosphorylated by PTPRJ. Phosphorylated by PIK3CA at Ser-608; phosphorylation is stimulated by insulin and PDGF. The relevance of phosphorylation by PIK3CA is however unclear (By similarity). Phosphorylated in response to KIT and KITLG/SCF. Phosphorylated by FGR.By similarity2 Publications

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-1539
CPTAC-1626
CPTAC-1740

Encyclopedia of Proteome Dynamics

More...
EPDi
P27986

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P27986

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P27986

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P27986

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P27986

PeptideAtlas

More...
PeptideAtlasi
P27986

PRoteomics IDEntifications database

More...
PRIDEi
P27986

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
18961
54429 [P27986-1]
54430 [P27986-2]
54431 [P27986-3]
54432 [P27986-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P27986

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P27986

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is expressed in skeletal muscle and brain, and at lower levels in kidney and cardiac muscle. Isoform 2 and isoform 4 are present in skeletal muscle (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000145675, Expressed in calcaneal tendon and 260 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P27986, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P27986, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000145675, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of a regulatory subunit PIK3R1 and a p110 catalytic subunit (PIK3CA, PIK3CB or PIK3CD).

Interacts (via SH2 domains) with CCDC88A/GIV (tyrosine-phosphorylated form); the interaction enables recruitment of PIK3R1 to the EGFR receptor, enhancing PI3K activity and cell migration (PubMed:21954290).

Interacts (via SH2 domain) with CSF1R (tyrosine phosphorylated).

Interacts with PIK3R2; the interaction is dissociated in an insulin-dependent manner (By similarity).

Interacts with XBP1 isoform 2; the interaction is direct and induces translocation of XBP1 isoform 2 into the nucleus in a ER stress- and/or insulin-dependent but PI3K-independent manner (PubMed:20348923).

Interacts with FER.

Interacts (via SH2 domain) with TEK/TIE2 (tyrosine phosphorylated).

Interacts with PTK2/FAK1 (By similarity).

Interacts with phosphorylated TOM1L1.

Interacts with phosphorylated LIME1 upon TCR and/or BCR activation.

Interacts with SOCS7.

Interacts with RUFY3.

Interacts (via SH2 domain) with CSF1R (tyrosine phosphorylated).

Interacts with LYN (via SH3 domain); this enhances enzyme activity (By similarity).

Interacts with phosphorylated LAT, LAX1 and TRAT1 upon TCR activation.

Interacts with CBLB. The SH2 domains interact with the YTHM motif of phosphorylated INSR in vitro.

Also interacts with tyrosine-phosphorylated IGF1R in vitro.

Interacts with CD28 and CD3Z upon T-cell activation.

Interacts with IRS1 and phosphorylated IRS4, as well as with NISCH and HCST.

Interacts with FASLG, KIT and BCR.

Interacts with AXL, FGFR1, FGFR2, FGFR3 and FGFR4 (phosphorylated).

Interacts with FGR and HCK.

Interacts with PDGFRA (tyrosine phosphorylated) and PDGFRB (tyrosine phosphorylated).

Interacts with ERBB4 (phosphorylated).

Interacts with NTRK1 (phosphorylated upon ligand-binding).

Interacts with FAM83B; activates the PI3K/AKT signaling cascade (PubMed:23676467).

Interacts with APPL1 and APPL2 (By similarity).

Interacts with SRC (PubMed:28903391).

Interacts with ALOX5; this interaction bridges ALOX5 with CD40 after CD40 ligation in B cells and leads to the production of reactive oxygen species (ROS) (PubMed:21200133).

By similarity31 Publications

(Microbial infection) Interacts with HIV-1 Nef to activate the Nef associated p21-activated kinase (PAK). This interaction depends on the C-terminus of both proteins and leads to increased production of HIV.

1 Publication

(Microbial infection) Interacts with HCV NS5A.

1 Publication

(Microbial infection) Interacts with herpes simplex virus 1 UL46; this interaction activates the PI3K/AKT pathway.

1 Publication

(Microbial infection) Interacts with herpes simplex virus 1 UL46 and varicella virus ORF12; this interaction activates the PI3K/AKT pathway.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

P27986
With#Exp.IntAct
ABI1 [Q8IZP0]8EBI-79464,EBI-375446
ABL2 [P42684]2EBI-79464,EBI-1102694
AR [P10275]5EBI-79464,EBI-608057
CBL [P22681]5EBI-79464,EBI-518228
CD28 [P10747]10EBI-79464,EBI-4314301
CHAF1A [Q13111]2EBI-79464,EBI-1020839
CMIP [Q8IY22]2EBI-79464,EBI-7689652
CRK [P46108]2EBI-79464,EBI-886
CRKL [P46109]2EBI-79464,EBI-910
CTLA4 [P16410]3EBI-79464,EBI-1030991
DLGAP4 [Q9Y2H0]2EBI-79464,EBI-722139
EGFR [P00533]5EBI-79464,EBI-297353
ELK3 [P41970]2EBI-79464,EBI-1758534
ERBB2 [P04626]11EBI-79464,EBI-641062
ERBB3 [P21860]41EBI-79464,EBI-720706
ESR1 [P03372]7EBI-79464,EBI-78473
FASLG [P48023]2EBI-79464,EBI-495538
FGFR1 [P11362]5EBI-79464,EBI-1028277
FLT1 [P17948]2EBI-79464,EBI-1026718
FLT3 [P36888]2EBI-79464,EBI-3946257
GAB1 [Q13480]33EBI-79464,EBI-517684
GRB10 [Q13322]2EBI-79464,EBI-80275
GRB2 [P62993]4EBI-79464,EBI-401755
HTT [P42858]7EBI-79464,EBI-466029
ICOS [Q9Y6W8]5EBI-79464,EBI-3922712
IGF1R [P08069]4EBI-79464,EBI-475981
INSR [P06213]3EBI-79464,EBI-475899
IRS1 [P35568]12EBI-79464,EBI-517592
IRS2 [Q9Y4H2]3EBI-79464,EBI-1049582
KIT [P10721]19EBI-79464,EBI-1379503
LAPTM4B - isoform 1 [Q86VI4-3]2EBI-79464,EBI-3267286
LAT [O43561]4EBI-79464,EBI-1222766
MAP4K1 [Q92918]2EBI-79464,EBI-881
MAPK8 [P45983]6EBI-79464,EBI-286483
MET [P08581]6EBI-79464,EBI-1039152
NELFB [Q8WX92]2EBI-79464,EBI-347721
PDGFRB [P09619]19EBI-79464,EBI-641237
PIK3CA [P42336]22EBI-79464,EBI-2116585
PIK3CB [P42338]3EBI-79464,EBI-2609540
PIK3CD [O00329]8EBI-79464,EBI-718309
PLCG2 [P16885]2EBI-79464,EBI-617403
PXN [P49023]2EBI-79464,EBI-702209
RAPGEF1 [Q13905]2EBI-79464,EBI-976876
RPL13 [P26373]2EBI-79464,EBI-356849
RXRA [P19793]8EBI-79464,EBI-78598
SHANK2 [Q9UPX8]2EBI-79464,EBI-1570571
SHC1 [P29353]3EBI-79464,EBI-78835
SIK2 [Q9H0K1]7EBI-79464,EBI-1181664
SIRT1 [Q96EB6]3EBI-79464,EBI-1802965
SOS1 [Q07889]3EBI-79464,EBI-297487
SRC [P12931]7EBI-79464,EBI-621482
SSTR2 [P30874]5EBI-79464,EBI-6266898
TGOLN2 [O43493]2EBI-79464,EBI-1752146
TIRAP [P58753]3EBI-79464,EBI-528644
TLR3 [O15455]2EBI-79464,EBI-6116630
TPSAB1 [Q15661]2EBI-79464,EBI-1761369
TPX2 [Q9ULW0]2EBI-79464,EBI-1037322
VAV3 [Q9UKW4]2EBI-79464,EBI-297568
Irs1 [P35570] from Rattus norvegicus.2EBI-79464,EBI-520230
NS [P03496] from Influenza A virus (strain A/Puerto Rico/8/1934 H1N1).6EBI-79464,EBI-2547442
Nyap1 [Q6PFX7] from Mus musculus.4EBI-79464,EBI-7447489
Nyap2 - isoform 4 [Q8BM65-4] from Mus musculus.3EBI-79464,EBI-7447598
VP3 [Q99152] from Chicken anemia virus (isolate Germany Cuxhaven-1).3EBI-79464,EBI-1776808
P0DOJ9 from Mus musculus polyomavirus 1.2EBI-79464,EBI-16746307
Isoform 2 [P27986-2]
With#Exp.IntAct
BLK [P51451]3EBI-9090282,EBI-2105445
IRS1 [P35568]3EBI-9090282,EBI-517592
PIK3CB [P42338]3EBI-9090282,EBI-2609540
PIK3CD [O00329]3EBI-9090282,EBI-718309
SH2D2A [Q9NP31]3EBI-9090282,EBI-490630
TXK [P42681]3EBI-9090282,EBI-7877438
ZDHHC17 [Q8IUH5]2EBI-9090282,EBI-524753

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
111313, 271 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P27986

Database of interacting proteins

More...
DIPi
DIP-119N

Protein interaction database and analysis system

More...
IntActi
P27986, 293 interactors

Molecular INTeraction database

More...
MINTi
P27986

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000428056

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P27986

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P27986, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1724
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
P27986

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P27986

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P27986

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3 – 79SH3PROSITE-ProRule annotationAdd BLAST77
Domaini113 – 301Rho-GAPPROSITE-ProRule annotationAdd BLAST189
Domaini333 – 428SH2 1PROSITE-ProRule annotationAdd BLAST96
Domaini624 – 718SH2 2PROSITE-ProRule annotationAdd BLAST95

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 domain mediates the binding to CBLB, and to HIV-1 Nef.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PI3K p85 subunit family.Curated

Keywords - Domaini

Repeat, SH2 domain, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4637, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155553

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_007031_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P27986

KEGG Orthology (KO)

More...
KOi
K02649

Identification of Orthologs from Complete Genome Data

More...
OMAi
LIKICHR

Database of Orthologous Groups

More...
OrthoDBi
737926at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P27986

TreeFam database of animal gene trees

More...
TreeFami
TF102033

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09930, SH2_cSH2_p85_like, 1 hit
cd09942, SH2_nSH2_p85_like, 1 hit
cd11910, SH3_PI3K_p85alpha, 1 hit

Database of protein disorder

More...
DisProti
DP01112

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
3.30.505.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032498, PI3K_P85_iSH2
IPR035591, PI3K_p85alpha_SH3
IPR035020, PI3kinase_P85_cSH2
IPR035022, PI3kinase_P85_nSH2
IPR008936, Rho_GTPase_activation_prot
IPR000198, RhoGAP_dom
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16454, PI3K_P85_iSH2, 1 hit
PF00620, RhoGAP, 1 hit
PF00017, SH2, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00401, SH2DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00324, RhoGAP, 1 hit
SM00252, SH2, 2 hits
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350, SSF48350, 1 hit
SSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50238, RHOGAP, 1 hit
PS50001, SH2, 2 hits
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P27986-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAEGYQYRA LYDYKKEREE DIDLHLGDIL TVNKGSLVAL GFSDGQEARP
60 70 80 90 100
EEIGWLNGYN ETTGERGDFP GTYVEYIGRK KISPPTPKPR PPRPLPVAPG
110 120 130 140 150
SSKTEADVEQ QALTLPDLAE QFAPPDIAPP LLIKLVEAIE KKGLECSTLY
160 170 180 190 200
RTQSSSNLAE LRQLLDCDTP SVDLEMIDVH VLADAFKRYL LDLPNPVIPA
210 220 230 240 250
AVYSEMISLA PEVQSSEEYI QLLKKLIRSP SIPHQYWLTL QYLLKHFFKL
260 270 280 290 300
SQTSSKNLLN ARVLSEIFSP MLFRFSAASS DNTENLIKVI EILISTEWNE
310 320 330 340 350
RQPAPALPPK PPKPTTVANN GMNNNMSLQD AEWYWGDISR EEVNEKLRDT
360 370 380 390 400
ADGTFLVRDA STKMHGDYTL TLRKGGNNKL IKIFHRDGKY GFSDPLTFSS
410 420 430 440 450
VVELINHYRN ESLAQYNPKL DVKLLYPVSK YQQDQVVKED NIEAVGKKLH
460 470 480 490 500
EYNTQFQEKS REYDRLYEEY TRTSQEIQMK RTAIEAFNET IKIFEEQCQT
510 520 530 540 550
QERYSKEYIE KFKREGNEKE IQRIMHNYDK LKSRISEIID SRRRLEEDLK
560 570 580 590 600
KQAAEYREID KRMNSIKPDL IQLRKTRDQY LMWLTQKGVR QKKLNEWLGN
610 620 630 640 650
ENTEDQYSLV EDDEDLPHHD EKTWNVGSSN RNKAENLLRG KRDGTFLVRE
660 670 680 690 700
SSKQGCYACS VVVDGEVKHC VINKTATGYG FAEPYNLYSS LKELVLHYQH
710 720
TSLVQHNDSL NVTLAYPVYA QQRR
Length:724
Mass (Da):83,598
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB9DAD8416C33140F
GO
Isoform 2 (identifier: P27986-2) [UniParc]FASTAAdd to basket
Also known as: AS53

The sequence of this isoform differs from the canonical sequence as follows:
     1-270: Missing.
     271-304: MLFRFSAASSDNTENLIKVIEILISTEWNERQPA → MYNTVWNMEDLDLEYAKTDINCGTDLMFYIEMDP

Show »
Length:454
Mass (Da):53,486
Checksum:i33BB0F88AA47CB3F
GO
Isoform 3 (identifier: P27986-3) [UniParc]FASTAAdd to basket
Also known as: p46

The sequence of this isoform differs from the canonical sequence as follows:
     1-300: Missing.
     301-306: RQPAPA → MHNLQT

Show »
Length:424
Mass (Da):49,965
Checksum:iEF2D6D4D668C62D8
GO
Isoform 4 (identifier: P27986-4) [UniParc]FASTAAdd to basket
Also known as: p85I

The sequence of this isoform differs from the canonical sequence as follows:
     605-605: D → ENFLSCLPS

Show »
Length:732
Mass (Da):84,474
Checksum:iF4820A783035803A
GO
Isoform 5 (identifier: P27986-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-363: Missing.

Show »
Length:361
Mass (Da):42,838
Checksum:i100325CF4D673C4B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RGI8E5RGI8_HUMAN
Phosphatidylinositol 3-kinase regul...
PIK3R1
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHI0E5RHI0_HUMAN
Phosphatidylinositol 3-kinase regul...
PIK3R1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBC2H0YBC2_HUMAN
Phosphatidylinositol 3-kinase regul...
PIK3R1
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJY0E5RJY0_HUMAN
Phosphatidylinositol 3-kinase regul...
PIK3R1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YB27H0YB27_HUMAN
Phosphatidylinositol 3-kinase regul...
PIK3R1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RK66E5RK66_HUMAN
Phosphatidylinositol 3-kinase regul...
PIK3R1
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti330D → N in M61906 (PubMed:1849461).Curated1
Sequence conflicti460S → G in BAG52931 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_010023326M → I Does not affect insulin-stimulated lipid kinase activity. 3 PublicationsCorresponds to variant dbSNP:rs3730089EnsemblClinVar.1
Natural variantiVAR_010024409R → Q in a patient with severe insulin resistance; lower insulin-stimulated lipid kinase activity compared with wild-type. 1 PublicationCorresponds to variant dbSNP:rs748784250Ensembl.1
Natural variantiVAR_029562451E → K1 PublicationCorresponds to variant dbSNP:rs17852841Ensembl.1
Natural variantiVAR_070221489E → K in SHORTS; there is 70 to 90% reduction in the effect of insulin on AKT1 activation, glycogen synthesis and glucose uptake, indicating severe insulin resistance for both proximal and distal PI3K-dependent signaling. 1 PublicationCorresponds to variant dbSNP:rs397514047EnsemblClinVar.1
Natural variantiVAR_070222539Missing in SHORTS; there is 70 to 90% reduction in the effect of insulin on AKT1 activation, glycogen synthesis and glucose uptake, indicating severe insulin resistance for both proximal and distal PI3K-dependent signaling. 1 Publication1
Natural variantiVAR_070223649R → W in SHORTS; impairs interaction between PIK3R1 and IRS1 and reduces AKT1-mediated insulin signaling. 2 PublicationsCorresponds to variant dbSNP:rs397515453EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0459031 – 363Missing in isoform 5. 1 PublicationAdd BLAST363
Alternative sequenceiVSP_0218411 – 300Missing in isoform 3. 1 PublicationAdd BLAST300
Alternative sequenceiVSP_0218421 – 270Missing in isoform 2. 3 PublicationsAdd BLAST270
Alternative sequenceiVSP_021843271 – 304MLFRF…ERQPA → MYNTVWNMEDLDLEYAKTDI NCGTDLMFYIEMDP in isoform 2. 3 PublicationsAdd BLAST34
Alternative sequenceiVSP_021844301 – 306RQPAPA → MHNLQT in isoform 3. 1 Publication6
Alternative sequenceiVSP_021845605D → ENFLSCLPS in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M61906 mRNA No translation available.
U49349 mRNA Translation: AAB04140.1
AF279367 mRNA Translation: AAO15359.1
AK094785 mRNA Translation: BAG52931.1
AK223613 mRNA Translation: BAD97333.1
AC016564 Genomic DNA No translation available.
AC104120 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51312.1
CH471137 Genomic DNA Translation: EAW51313.1
BC030815 mRNA Translation: AAH30815.1
BC094795 mRNA Translation: AAH94795.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3993.1 [P27986-1]
CCDS3994.1 [P27986-3]
CCDS3995.1 [P27986-2]
CCDS56374.1 [P27986-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
A38748

NCBI Reference Sequences

More...
RefSeqi
NP_001229395.1, NM_001242466.1 [P27986-5]
NP_852556.2, NM_181504.3 [P27986-2]
NP_852664.1, NM_181523.2 [P27986-1]
NP_852665.1, NM_181524.1 [P27986-3]
XP_005248599.1, XM_005248542.3 [P27986-1]
XP_016865074.1, XM_017009585.1 [P27986-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000320694; ENSP00000323512; ENSG00000145675 [P27986-3]
ENST00000336483; ENSP00000338554; ENSG00000145675 [P27986-2]
ENST00000521381; ENSP00000428056; ENSG00000145675 [P27986-1]
ENST00000521657; ENSP00000429277; ENSG00000145675 [P27986-1]
ENST00000523872; ENSP00000430098; ENSG00000145675 [P27986-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5295

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5295

UCSC genome browser

More...
UCSCi
uc003jva.4, human [P27986-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M61906 mRNA No translation available.
U49349 mRNA Translation: AAB04140.1
AF279367 mRNA Translation: AAO15359.1
AK094785 mRNA Translation: BAG52931.1
AK223613 mRNA Translation: BAD97333.1
AC016564 Genomic DNA No translation available.
AC104120 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51312.1
CH471137 Genomic DNA Translation: EAW51313.1
BC030815 mRNA Translation: AAH30815.1
BC094795 mRNA Translation: AAH94795.1
CCDSiCCDS3993.1 [P27986-1]
CCDS3994.1 [P27986-3]
CCDS3995.1 [P27986-2]
CCDS56374.1 [P27986-5]
PIRiA38748
RefSeqiNP_001229395.1, NM_001242466.1 [P27986-5]
NP_852556.2, NM_181504.3 [P27986-2]
NP_852664.1, NM_181523.2 [P27986-1]
NP_852665.1, NM_181524.1 [P27986-3]
XP_005248599.1, XM_005248542.3 [P27986-1]
XP_016865074.1, XM_017009585.1 [P27986-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A0NNMR-A91-104[»]
1AZGNMR-A91-104[»]
1H9OX-ray1.79A617-724[»]
1PBWX-ray2.00A/B105-319[»]
1PHTX-ray2.00A1-85[»]
1PICNMR-A617-724[»]
1PKSNMR-A1-79[»]
1PKTNMR-A1-79[»]
2IUGX-ray1.89A321-440[»]
2IUHX-ray2.00A321-440[»]
2IUIX-ray2.40A/B321-440[»]
2RD0X-ray3.05B322-600[»]
2V1YX-ray2.40B431-600[»]
3HHMX-ray2.80B322-694[»]
3HIZX-ray3.30B322-694[»]
3I5RX-ray1.70A1-83[»]
3I5SX-ray3.00A/B/C/D1-83[»]
4A55X-ray3.50B322-600[»]
4JPSX-ray2.20B307-593[»]
4L1BX-ray2.59B318-615[»]
4L23X-ray2.50B318-615[»]
4L2YX-ray2.80B318-615[»]
4OVUX-ray2.96B322-600[»]
4OVVX-ray3.50B322-600[»]
4WAFX-ray2.39B306-617[»]
4YKNX-ray2.90A318-615[»]
4ZOPX-ray2.62B307-590[»]
5AULX-ray1.10A614-720[»]
5FI4X-ray2.50B306-617[»]
5GJIX-ray0.90A325-430[»]
5ITDX-ray3.02B307-617[»]
5M6UX-ray2.85B1-724[»]
5SW8X-ray3.30B322-600[»]
5SWGX-ray3.11B322-600[»]
5SWOX-ray3.50B322-600[»]
5SWPX-ray3.41B322-600[»]
5SWRX-ray3.31B322-600[»]
5SWTX-ray3.49B322-600[»]
5SX8X-ray3.47B322-600[»]
5SX9X-ray3.52B322-600[»]
5SXAX-ray3.35B322-600[»]
5SXBX-ray3.30B322-600[»]
5SXCX-ray3.55B322-600[»]
5SXDX-ray3.50B322-600[»]
5SXEX-ray3.51B322-600[»]
5SXFX-ray3.46B322-600[»]
5SXIX-ray3.40B322-600[»]
5SXJX-ray3.42B322-600[»]
5SXKX-ray3.55B322-600[»]
5UBTX-ray2.83B432-599[»]
5UK8X-ray2.50B306-593[»]
5UKJX-ray2.80B306-593[»]
5UL1X-ray3.00B306-593[»]
5VLRX-ray2.80B431-600[»]
5XGHX-ray2.97B322-598[»]
5XGIX-ray2.56B322-598[»]
5XGJX-ray2.97B322-599[»]
6NCTX-ray3.35B322-600[»]
6PYRX-ray2.21B431-599[»]
6PYUX-ray2.54B431-599[»]
BMRBiP27986
SMRiP27986
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111313, 271 interactors
CORUMiP27986
DIPiDIP-119N
IntActiP27986, 293 interactors
MINTiP27986
STRINGi9606.ENSP00000428056

Chemistry databases

BindingDBiP27986
ChEMBLiCHEMBL2506
DrugBankiDB06486, Enzastaurin
DB01064, Isoprenaline
DB05210, SF1126
DB08059, Wortmannin
DrugCentraliP27986

Protein family/group databases

MoonDBiP27986, Predicted

PTM databases

iPTMnetiP27986
PhosphoSitePlusiP27986

Polymorphism and mutation databases

BioMutaiPIK3R1
DMDMi118572681

Proteomic databases

CPTACiCPTAC-1539
CPTAC-1626
CPTAC-1740
EPDiP27986
jPOSTiP27986
MassIVEiP27986
MaxQBiP27986
PaxDbiP27986
PeptideAtlasiP27986
PRIDEiP27986
ProteomicsDBi18961
54429 [P27986-1]
54430 [P27986-2]
54431 [P27986-3]
54432 [P27986-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
717, 1078 antibodies

The DNASU plasmid repository

More...
DNASUi
5295

Genome annotation databases

EnsembliENST00000320694; ENSP00000323512; ENSG00000145675 [P27986-3]
ENST00000336483; ENSP00000338554; ENSG00000145675 [P27986-2]
ENST00000521381; ENSP00000428056; ENSG00000145675 [P27986-1]
ENST00000521657; ENSP00000429277; ENSG00000145675 [P27986-1]
ENST00000523872; ENSP00000430098; ENSG00000145675 [P27986-5]
GeneIDi5295
KEGGihsa:5295
UCSCiuc003jva.4, human [P27986-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5295
DisGeNETi5295
EuPathDBiHostDB:ENSG00000145675.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PIK3R1
GeneReviewsiPIK3R1
HGNCiHGNC:8979, PIK3R1
HPAiENSG00000145675, Low tissue specificity
MalaCardsiPIK3R1
MIMi171833, gene
269880, phenotype
615214, phenotype
616005, phenotype
neXtProtiNX_P27986
OpenTargetsiENSG00000145675
Orphaneti397596, Activated PI3K-delta syndrome
33110, Autosomal agammaglobulinemia
3163, SHORT syndrome
PharmGKBiPA33312

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4637, Eukaryota
GeneTreeiENSGT00940000155553
HOGENOMiCLU_007031_1_0_1
InParanoidiP27986
KOiK02649
OMAiLIKICHR
OrthoDBi737926at2759
PhylomeDBiP27986
TreeFamiTF102033

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000145675-MONOMER
BRENDAi2.7.1.153, 2681
PathwayCommonsiP27986
ReactomeiR-HSA-109704, PI3K Cascade
R-HSA-112399, IRS-mediated signalling
R-HSA-114604, GPVI-mediated activation cascade
R-HSA-1236382, Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
R-HSA-1250342, PI3K events in ERBB4 signaling
R-HSA-1257604, PIP3 activates AKT signaling
R-HSA-1266695, Interleukin-7 signaling
R-HSA-1433557, Signaling by SCF-KIT
R-HSA-1660499, Synthesis of PIPs at the plasma membrane
R-HSA-180292, GAB1 signalosome
R-HSA-1839117, Signaling by cytosolic FGFR1 fusion mutants
R-HSA-186763, Downstream signal transduction
R-HSA-1963642, PI3K events in ERBB2 signaling
R-HSA-198203, PI3K/AKT activation
R-HSA-202424, Downstream TCR signaling
R-HSA-2029485, Role of phospholipids in phagocytosis
R-HSA-210993, Tie2 Signaling
R-HSA-2219530, Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-2424491, DAP12 signaling
R-HSA-2730905, Role of LAT2/NTAL/LAB on calcium mobilization
R-HSA-373753, Nephrin family interactions
R-HSA-388841, Costimulation by the CD28 family
R-HSA-389357, CD28 dependent PI3K/Akt signaling
R-HSA-416476, G alpha (q) signalling events
R-HSA-430116, GP1b-IX-V activation signalling
R-HSA-4420097, VEGFA-VEGFR2 Pathway
R-HSA-512988, Interleukin-3, Interleukin-5 and GM-CSF signaling
R-HSA-5637810, Constitutive Signaling by EGFRvIII
R-HSA-5654689, PI-3K cascade:FGFR1
R-HSA-5654695, PI-3K cascade:FGFR2
R-HSA-5654710, PI-3K cascade:FGFR3
R-HSA-5654720, PI-3K cascade:FGFR4
R-HSA-5655253, Signaling by FGFR2 in disease
R-HSA-5655291, Signaling by FGFR4 in disease
R-HSA-5655302, Signaling by FGFR1 in disease
R-HSA-6785807, Interleukin-4 and Interleukin-13 signaling
R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8851907, MET activates PI3K/AKT signaling
R-HSA-8853334, Signaling by FGFR3 fusions in cancer
R-HSA-8853338, Signaling by FGFR3 point mutants in cancer
R-HSA-8853659, RET signaling
R-HSA-9009391, Extra-nuclear estrogen signaling
R-HSA-9027276, Erythropoietin activates Phosphoinositide-3-kinase (PI3K)
R-HSA-9028335, Activated NTRK2 signals through PI3K
R-HSA-912526, Interleukin receptor SHC signaling
R-HSA-912631, Regulation of signaling by CBL
R-HSA-9603381, Activated NTRK3 signals through PI3K
R-HSA-9607240, FLT3 Signaling
R-HSA-9664565, Signaling by ERBB2 KD Mutants
R-HSA-9665348, Signaling by ERBB2 ECD mutants
R-HSA-9673767, Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants
R-HSA-9673770, Signaling by PDGFRA extracellular domain mutants
R-HSA-983695, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
SignaLinkiP27986
SIGNORiP27986

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
5295, 19 hits in 889 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PIK3R1, human
EvolutionaryTraceiP27986

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PIK3R1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5295
PharosiP27986, Tchem

Protein Ontology

More...
PROi
PR:P27986
RNActiP27986, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000145675, Expressed in calcaneal tendon and 260 other tissues
ExpressionAtlasiP27986, baseline and differential
GenevisibleiP27986, HS

Family and domain databases

CDDicd09930, SH2_cSH2_p85_like, 1 hit
cd09942, SH2_nSH2_p85_like, 1 hit
cd11910, SH3_PI3K_p85alpha, 1 hit
DisProtiDP01112
Gene3Di1.10.555.10, 1 hit
3.30.505.10, 2 hits
InterProiView protein in InterPro
IPR032498, PI3K_P85_iSH2
IPR035591, PI3K_p85alpha_SH3
IPR035020, PI3kinase_P85_cSH2
IPR035022, PI3kinase_P85_nSH2
IPR008936, Rho_GTPase_activation_prot
IPR000198, RhoGAP_dom
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
PfamiView protein in Pfam
PF16454, PI3K_P85_iSH2, 1 hit
PF00620, RhoGAP, 1 hit
PF00017, SH2, 2 hits
PRINTSiPR00401, SH2DOMAIN
SMARTiView protein in SMART
SM00324, RhoGAP, 1 hit
SM00252, SH2, 2 hits
SM00326, SH3, 1 hit
SUPFAMiSSF48350, SSF48350, 1 hit
SSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 2 hits
PROSITEiView protein in PROSITE
PS50238, RHOGAP, 1 hit
PS50001, SH2, 2 hits
PS50002, SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiP85A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P27986
Secondary accession number(s): B3KT19
, D3DWA0, E7EX19, Q15747, Q4VBZ7, Q53EM6, Q8IXA2, Q8N1C5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: November 28, 2006
Last modified: October 7, 2020
This is version 244 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again