Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calnexin

Gene

CANX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins. Associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, it may function as a signaling complex regulating thymocyte maturation. Additionally it may play a role in receptor-mediated endocytosis at the synapse.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi74Calcium; via carbonyl oxygenBy similarity1
Metal bindingi117Calcium; via carbonyl oxygenBy similarity1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei164CarbohydrateBy similarity1
Binding sitei166CarbohydrateBy similarity1
Binding sitei185CarbohydrateBy similarity1
Binding sitei216CarbohydrateBy similarity1
Metal bindingi436CalciumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone
LigandCalcium, Lectin, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-168316 Assembly of Viral Components at the Budding Site
R-HSA-2132295 MHC class II antigen presentation
R-HSA-8984722 Interleukin-35 Signalling
R-HSA-901042 Calnexin/calreticulin cycle
R-HSA-9020956 Interleukin-27 signaling
R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calnexin
Alternative name(s):
IP90
Major histocompatibility complex class I antigen-binding protein p88
p90
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CANX
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000127022.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1473 CANX

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
114217 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P27824

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini21 – 481LumenalSequence analysisAdd BLAST461
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei482 – 502HelicalSequence analysisAdd BLAST21
Topological domaini503 – 592CytoplasmicSequence analysisAdd BLAST90

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
821

Open Targets

More...
OpenTargetsi
ENSG00000127022

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26055

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2719

Drug and drug target database

More...
DrugBanki
DB00025 Antihemophilic Factor (Recombinant)
DB00031 Tenecteplase

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CANX

Domain mapping of disease mutations (DMDM)

More...
DMDMi
543920

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Sequence analysisCombined sourcesAdd BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000419821 – 592CalnexinAdd BLAST572

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei137N6-acetyllysineCombined sources1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi160 ↔ 194By similarity
Disulfide bondi360 ↔ 366By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi502S-palmitoyl cysteine1 Publication1
Lipidationi503S-palmitoyl cysteine1 Publication1
Modified residuei554PhosphoserineCombined sources1
Modified residuei562PhosphothreonineCombined sources1
Modified residuei564Phosphoserine; by MAPK3Combined sources1
Modified residuei583PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Ser-564 by MAPK3/ERK1. phosphorylation by MAPK3/ERK1 increases its association with ribosomes (By similarity).By similarity
Palmitoylation by DHHC6 leads to the preferential localization to the perinuclear rough ER. It mediates the association of calnexin with the ribosome-translocon complex (RTC) which is required for efficient folding of glycosylated proteins.1 Publication
Ubiquitinated, leading to proteasomal degradation. Probably ubiquitinated by ZNRF4.1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P27824

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P27824

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P27824

PeptideAtlas

More...
PeptideAtlasi
P27824

PRoteomics IDEntifications database

More...
PRIDEi
P27824

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54425

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P27824-1 [P27824-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P27824

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P27824

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P27824

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000127022 Expressed in 233 organ(s), highest expression level in oviduct epithelium

CleanEx database of gene expression profiles

More...
CleanExi
HS_CANX

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P27824 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P27824 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004738
HPA009433
HPA009696

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAPK3/ERK1 (By similarity). Interacts with KCNH2 (PubMed:16361248). Associates with ribosomes (By similarity). Interacts with SGIP1; involved in negative regulation of endocytosis (By similarity). The palmitoylated form interacts with the ribosome-translocon complex component SSR1, promoting efficient folding of glycoproteins (PubMed:22314232). Interacts with SERPINA2P/SERPINA2 and with the S and Z variants of SERPINA1 (PubMed:23826168). Interacts with PPIB (PubMed:20801878). Interacts with ZNRF4 (PubMed:21205830).By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107271, 264 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P27824

Database of interacting proteins

More...
DIPi
DIP-457N

Protein interaction database and analysis system

More...
IntActi
P27824, 401 interactors

Molecular INTeraction database

More...
MINTi
P27824

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000247461

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P27824

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P27824

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati278 – 2901-1Add BLAST13
Repeati295 – 3071-2Add BLAST13
Repeati314 – 3261-3Add BLAST13
Repeati333 – 3451-4Add BLAST13
Repeati348 – 3582-1Add BLAST11
Repeati367 – 3772-2Add BLAST11
Repeati381 – 3912-3Add BLAST11
Repeati395 – 4052-4Add BLAST11

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni276 – 409P domain (Extended arm)By similarityAdd BLAST134
Regioni278 – 3454 X approximate repeatsAdd BLAST68
Regioni326 – 359Interaction with PPIBBy similarityAdd BLAST34
Regioni348 – 4054 X approximate repeatsAdd BLAST58
Regioni503 – 592Sufficient to mediate interaction with SGIP1By similarityAdd BLAST90

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the calreticulin family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0675 Eukaryota
ENOG410XP7T LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153639

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000192436

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005407

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P27824

KEGG Orthology (KO)

More...
KOi
K08054

Identification of Orthologs from Complete Genome Data

More...
OMAi
FCCSGKK

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04SS

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P27824

TreeFam database of animal gene trees

More...
TreeFami
TF300618

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.10.250.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001580 Calret/calnex
IPR018124 Calret/calnex_CS
IPR009033 Calreticulin/calnexin_P_dom_sf
IPR013320 ConA-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11073 PTHR11073, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00262 Calreticulin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00626 CALRETICULIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 2 hits
SSF63887 SSF63887, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00803 CALRETICULIN_1, 1 hit
PS00804 CALRETICULIN_2, 1 hit
PS00805 CALRETICULIN_REPEAT, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P27824-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGKWLLCML LVLGTAIVEA HDGHDDDVID IEDDLDDVIE EVEDSKPDTT
60 70 80 90 100
APPSSPKVTY KAPVPTGEVY FADSFDRGTL SGWILSKAKK DDTDDEIAKY
110 120 130 140 150
DGKWEVEEMK ESKLPGDKGL VLMSRAKHHA ISAKLNKPFL FDTKPLIVQY
160 170 180 190 200
EVNFQNGIEC GGAYVKLLSK TPELNLDQFH DKTPYTIMFG PDKCGEDYKL
210 220 230 240 250
HFIFRHKNPK TGIYEEKHAK RPDADLKTYF TDKKTHLYTL ILNPDNSFEI
260 270 280 290 300
LVDQSVVNSG NLLNDMTPPV NPSREIEDPE DRKPEDWDER PKIPDPEAVK
310 320 330 340 350
PDDWDEDAPA KIPDEEATKP EGWLDDEPEY VPDPDAEKPE DWDEDMDGEW
360 370 380 390 400
EAPQIANPRC ESAPGCGVWQ RPVIDNPNYK GKWKPPMIDN PSYQGIWKPR
410 420 430 440 450
KIPNPDFFED LEPFRMTPFS AIGLELWSMT SDIFFDNFII CADRRIVDDW
460 470 480 490 500
ANDGWGLKKA ADGAAEPGVV GQMIEAAEER PWLWVVYILT VALPVFLVIL
510 520 530 540 550
FCCSGKKQTS GMEYKKTDAP QPDVKEEEEE KEEEKDKGDE EEEGEEKLEE
560 570 580 590
KQKSDAEEDG GTVSQEEEDR KPKAEEDEIL NRSPRNRKPR RE
Length:592
Mass (Da):67,568
Last modified:June 1, 1994 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEDE094D9B82261EE
GO
Isoform 2 (identifier: P27824-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADRRTPTPFAGCRLPRQRRARDASQVSAPGTRRIM

Note: No experimental confirmation available.
Show »
Length:627
Mass (Da):71,503
Checksum:iE9AD69A866261080
GO
Isoform 3 (identifier: P27824-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Note: No experimental confirmation available.
Show »
Length:484
Mass (Da):55,598
Checksum:i61BB56B36E8C7A4C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RGY2D6RGY2_HUMAN
Calnexin
CANX
308Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDP7D6RDP7_HUMAN
Calnexin
CANX
168Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RB85D6RB85_HUMAN
Calnexin
CANX
144Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAU8D6RAU8_HUMAN
Calnexin
CANX
134Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAQ8D6RAQ8_HUMAN
Calnexin
CANX
107Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFL1D6RFL1_HUMAN
Calnexin
CANX
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9Q7H0Y9Q7_HUMAN
Calnexin
CANX
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9H1H0Y9H1_HUMAN
Calnexin
CANX
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RG29D6RG29_HUMAN
Calnexin
CANX
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD16D6RD16_HUMAN
Calnexin
CANX
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti179F → L in AAA21749 (PubMed:8136357).Curated1
Sequence conflicti431 – 433SDI → LTF in AAA35696 (PubMed:1326756).Curated3
Sequence conflicti480R → L in AAA35696 (PubMed:1326756).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0555151 – 108Missing in isoform 3. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_0555161M → MADRRTPTPFAGCRLPRQRR ARDASQVSAPGTRRIM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L10284 mRNA Translation: AAA36125.1
L18887 mRNA Translation: AAA21013.1
M94859 mRNA Translation: AAA21749.1
M98452 mRNA Translation: AAA35696.1
AK294702 mRNA Translation: BAG57859.1
AK304420 mRNA Translation: BAG65250.1
AK312334 mRNA Translation: BAG35255.1
AC113426 Genomic DNA No translation available.
AC136604 Genomic DNA No translation available.
CH471165 Genomic DNA Translation: EAW53802.1
CH471165 Genomic DNA Translation: EAW53803.1
CH471165 Genomic DNA Translation: EAW53805.1
BC003552 mRNA Translation: AAH03552.1
BC042843 mRNA Translation: AAH42843.1
AJ271880 mRNA Translation: CAB72137.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4447.1 [P27824-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A46164
A46673
I53260

NCBI Reference Sequences

More...
RefSeqi
NP_001019820.1, NM_001024649.1 [P27824-1]
NP_001737.1, NM_001746.3 [P27824-1]
XP_011532967.1, XM_011534665.2 [P27824-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.567968

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000247461; ENSP00000247461; ENSG00000127022 [P27824-1]
ENST00000452673; ENSP00000391646; ENSG00000127022 [P27824-1]
ENST00000504734; ENSP00000424063; ENSG00000127022 [P27824-1]
ENST00000638425; ENSP00000492372; ENSG00000283777 [P27824-1]
ENST00000638706; ENSP00000492868; ENSG00000283777 [P27824-1]
ENST00000639938; ENSP00000491760; ENSG00000283777 [P27824-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
821

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:821

UCSC genome browser

More...
UCSCi
uc003mkk.4 human [P27824-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Calnexin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10284 mRNA Translation: AAA36125.1
L18887 mRNA Translation: AAA21013.1
M94859 mRNA Translation: AAA21749.1
M98452 mRNA Translation: AAA35696.1
AK294702 mRNA Translation: BAG57859.1
AK304420 mRNA Translation: BAG65250.1
AK312334 mRNA Translation: BAG35255.1
AC113426 Genomic DNA No translation available.
AC136604 Genomic DNA No translation available.
CH471165 Genomic DNA Translation: EAW53802.1
CH471165 Genomic DNA Translation: EAW53803.1
CH471165 Genomic DNA Translation: EAW53805.1
BC003552 mRNA Translation: AAH03552.1
BC042843 mRNA Translation: AAH42843.1
AJ271880 mRNA Translation: CAB72137.1
CCDSiCCDS4447.1 [P27824-1]
PIRiA46164
A46673
I53260
RefSeqiNP_001019820.1, NM_001024649.1 [P27824-1]
NP_001737.1, NM_001746.3 [P27824-1]
XP_011532967.1, XM_011534665.2 [P27824-1]
UniGeneiHs.567968

3D structure databases

ProteinModelPortaliP27824
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107271, 264 interactors
CORUMiP27824
DIPiDIP-457N
IntActiP27824, 401 interactors
MINTiP27824
STRINGi9606.ENSP00000247461

Chemistry databases

BindingDBiP27824
ChEMBLiCHEMBL2719
DrugBankiDB00025 Antihemophilic Factor (Recombinant)
DB00031 Tenecteplase

PTM databases

iPTMnetiP27824
PhosphoSitePlusiP27824
SwissPalmiP27824

Polymorphism and mutation databases

BioMutaiCANX
DMDMi543920

Proteomic databases

EPDiP27824
MaxQBiP27824
PaxDbiP27824
PeptideAtlasiP27824
PRIDEiP27824
ProteomicsDBi54425
TopDownProteomicsiP27824-1 [P27824-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
821
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000247461; ENSP00000247461; ENSG00000127022 [P27824-1]
ENST00000452673; ENSP00000391646; ENSG00000127022 [P27824-1]
ENST00000504734; ENSP00000424063; ENSG00000127022 [P27824-1]
ENST00000638425; ENSP00000492372; ENSG00000283777 [P27824-1]
ENST00000638706; ENSP00000492868; ENSG00000283777 [P27824-1]
ENST00000639938; ENSP00000491760; ENSG00000283777 [P27824-1]
GeneIDi821
KEGGihsa:821
UCSCiuc003mkk.4 human [P27824-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
821
DisGeNETi821
EuPathDBiHostDB:ENSG00000127022.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CANX
HGNCiHGNC:1473 CANX
HPAiCAB004738
HPA009433
HPA009696
MIMi114217 gene
neXtProtiNX_P27824
OpenTargetsiENSG00000127022
PharmGKBiPA26055

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0675 Eukaryota
ENOG410XP7T LUCA
GeneTreeiENSGT00940000153639
HOGENOMiHOG000192436
HOVERGENiHBG005407
InParanoidiP27824
KOiK08054
OMAiFCCSGKK
OrthoDBiEOG091G04SS
PhylomeDBiP27824
TreeFamiTF300618

Enzyme and pathway databases

ReactomeiR-HSA-168316 Assembly of Viral Components at the Budding Site
R-HSA-2132295 MHC class II antigen presentation
R-HSA-8984722 Interleukin-35 Signalling
R-HSA-901042 Calnexin/calreticulin cycle
R-HSA-9020956 Interleukin-27 signaling
R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CANX human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Calnexin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
821

Protein Ontology

More...
PROi
PR:P27824

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000127022 Expressed in 233 organ(s), highest expression level in oviduct epithelium
CleanExiHS_CANX
ExpressionAtlasiP27824 baseline and differential
GenevisibleiP27824 HS

Family and domain databases

Gene3Di2.10.250.10, 1 hit
InterProiView protein in InterPro
IPR001580 Calret/calnex
IPR018124 Calret/calnex_CS
IPR009033 Calreticulin/calnexin_P_dom_sf
IPR013320 ConA-like_dom_sf
PANTHERiPTHR11073 PTHR11073, 1 hit
PfamiView protein in Pfam
PF00262 Calreticulin, 1 hit
PRINTSiPR00626 CALRETICULIN
SUPFAMiSSF49899 SSF49899, 2 hits
SSF63887 SSF63887, 1 hit
PROSITEiView protein in PROSITE
PS00803 CALRETICULIN_1, 1 hit
PS00804 CALRETICULIN_2, 1 hit
PS00805 CALRETICULIN_REPEAT, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCALX_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P27824
Secondary accession number(s): B2R5V8
, B4DGP8, B4E2T8, D3DWQ3, D6R9K3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: June 1, 1994
Last modified: December 5, 2018
This is version 211 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again