UniProtKB - P27600 (GNA12_MOUSE)

BLAST

>sp|P27600|GNA12_MOUSE Guanine nucleotide-binding protein subunit alpha-12 OS=Mus musculus OX=10090 GN=Gna12 PE=1 SV=3
MSGVVRTLSRCLLPAEAGARERRAGAARDAEREARRRSRDIDALLARERRAVRRLVKILL
LGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHS
ENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYF
LDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCF
DGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLV
EKVKSVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENIRFV
FHAVKDTILQENLKDIMLQ

Align
Format
Add to basket Added to basket
History
Entry version 164 (07 Nov 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Guanine nucleotide-binding protein subunit alpha-12

Gene

Gna12

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (PubMed:19151758, PubMed:21212405, PubMed:22609986). Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF12/LARG) (By similarity). GNA12-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1) (PubMed:19151758, PubMed:21212405). GNA12-dependent Rho signaling also regulates protein phosphatese 2A activation causing dephosphorylation of its target proteins (By similarity). Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway and up-regulating proinflammatory cytokine production (By similarity). Inhibits CDH1-mediated cell adhesion in process independent from Rho activation (By similarity). Together with NAPA promotes CDH5 localization to plasma membrane (By similarity). May play a role in the control of cell migration through the TOR signaling cascade (PubMed:22609986).By similarity3 Publications

Sites

Feature key	Position(s)	DescriptionActions	Length
Metal bindingⁱ	69	Magnesium1 Publication	1
Metal bindingⁱ	206	Magnesium1 Publication	1
Binding siteⁱ	351	GTP; via amide nitrogenCombined sources1 Publication	1

Regions

Feature key	Position(s)	DescriptionActions	Length
Nucleotide bindingⁱ	65 – 70	GTPCombined sources1 Publication	6
Nucleotide bindingⁱ	200 – 203	GTPCombined sources1 Publication	4
Nucleotide bindingⁱ	294 – 297	GTPCombined sources1 Publication	4

GO - Molecular functionⁱ

D5 dopamine receptor binding Source: MGI
G-protein beta/gamma-subunit complex binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
G protein-coupled receptor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
GTPase activity
Source: MGI
Inferred from sequence alignmentⁱ
- 2508088
GTP binding Source: UniProtKB-KW
metal ion binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

adenylate cyclase-modulating G protein-coupled receptor signaling pathway
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
cell differentiation
Source: MGI
Inferred from direct assayⁱ
- 9305907
embryonic digit morphogenesis
Source: MGI
Inferred from genetic interactionⁱ
- 12077299
G protein-coupled receptor signaling pathway
Source: MGI
Inferred from sequence alignmentⁱ
- 2508088
intracellular signal transduction
Source: MGI
Inferred from direct assayⁱ
- 10037795
in utero embryonic development
Source: MGI
Inferred from genetic interactionⁱ
- 12077299
regulation of cell shape
Source: MGI
Inferred from direct assayⁱ
- 10037795
regulation of fibroblast migration
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 22609986
regulation of proteasomal ubiquitin-dependent protein catabolic process
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 22609986
regulation of TOR signaling
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 22609986
response to drug Source: Ensembl
Rho protein signal transduction
Source: MGI
Inferred from direct assayⁱ
- 10037795

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Transducer
Ligand	GTP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactomeⁱ	R-MMU-416482 G alpha (12/13) signalling events R-MMU-456926 Thrombin signalling through proteinase activated receptors (PARs)

Reactomeⁱ

R-MMU-416482 G alpha (12/13) signalling events
R-MMU-456926 Thrombin signalling through proteinase activated receptors (PARs)

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Guanine nucleotide-binding protein subunit alpha-12 Short name: G alpha-12 Short name: G-protein subunit alpha-12
Gene namesⁱ	Name:Gna12 Synonyms:Gna-12
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 5

Organism-specific databases

MGIⁱ	MGI:95767 Gna12

Keywords - Cellular componentⁱ

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	2	S → G: Results in myristoylation of G-2, which restores the transformation activity; when associated with S-6. 1 Publication	1
Mutagenesisⁱ	6	R → S: Results in myristoylation of G-2, which restores the transformation activity; when associated with G-2. 1 Publication	1
Mutagenesisⁱ	11	C → S: Abolishes palmitoylation and transformation activity. 1 Publication	1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000203771	1 – 379	Guanine nucleotide-binding protein subunit alpha-12Add BLAST		379

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Lipidationⁱ	11	S-palmitoyl cysteine1 Publication		1
Modified residueⁱ	206	PhosphothreonineBy similarity		1

Post-translational modificationⁱ

Myristoylation of mutated N-terminus in place of original palmitoylation restores the transformation activity.1 Publication

Keywords - PTMⁱ

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P27600
PaxDbⁱ	P27600
PeptideAtlas More...PeptideAtlasⁱ	P27600
PRIDEⁱ	P27600

PTM databases

iPTMnetⁱ	P27600
PhosphoSitePlusⁱ	P27600
SwissPalmⁱ	P27600

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000000149 Expressed in 276 organ(s), highest expression level in cardiac ventricle
CleanExⁱ	MM_GNA12
ExpressionAtlasⁱ	P27600 baseline and differential
Genevisibleⁱ	P27600 MM

Interactionⁱ

Subunit structureⁱ

G proteins are composed of 3 units; alpha, beta and gamma (PubMed:16388592). The alpha chain contains the guanine nucleotide binding site (PubMed:16388592). Interacts with UBXD5 (By similarity). Interacts (in GTP-bound form) with PPP5C (via TPR repeats); activates PPP5C phosphatase activity and translocates PPP5C to the cell membrane (By similarity). Interacts with RGS22 (By similarity). Interacts (via N-terminus) with NAPA; the interaction promotes CDH5 localization to plasma membrane (By similarity). Interacts with CTNND1 (via N-terminus); the interaction regulates CDH1-mediated cell-cell adhesion (PubMed:15240885). Interacts with PPP2R1A; the interaction promotes protein phosphatase 2A activation causing dephosphorylation of MAPT (By similarity). Interacts (in GTP-bound form) with ARHGEF1 (PubMed:16388592). Interacts (in GTP-bound form) with ARHGEF11 (via RGS domain) (By similarity). Interacts (in GTP-bound form) with ARHGEF12 (via RGS domain) (PubMed:16388592).By similarity2 Publications

GO - Molecular functionⁱ

D5 dopamine receptor binding Source: MGI
G protein-coupled receptor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

IntActⁱ	P27600, 3 interactors
Molecular INTeraction database More...MINTⁱ	P27600
STRINGⁱ	10090.ENSMUSP00000000153

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	56 – 67	Combined sources	12
Helixⁱ	68 – 79	Combined sources	12
Helixⁱ	85 – 112	Combined sources	28
Helixⁱ	120 – 122	Combined sources	3
Helixⁱ	123 – 130	Combined sources	8
Helixⁱ	142 – 157	Combined sources	16
Helixⁱ	159 – 166	Combined sources	8
Helixⁱ	168 – 170	Combined sources	3
Helixⁱ	176 – 182	Combined sources	7
Helixⁱ	184 – 187	Combined sources	4
Helixⁱ	196 – 201	Combined sources	6
Beta strandⁱ	208 – 216	Combined sources	9
Beta strandⁱ	219 – 226	Combined sources	8
Helixⁱ	230 – 233	Combined sources	4
Helixⁱ	234 – 238	Combined sources	5
Turnⁱ	239 – 242	Combined sources	4
Beta strandⁱ	244 – 251	Combined sources	8
Beta strandⁱ	260 – 266	Combined sources	7
Helixⁱ	267 – 279	Combined sources	13
Helixⁱ	282 – 284	Combined sources	3
Beta strandⁱ	287 – 294	Combined sources	8
Helixⁱ	296 – 305	Combined sources	10
Turnⁱ	309 – 311	Combined sources	3
Helixⁱ	322 – 335	Combined sources	14
Beta strandⁱ	346 – 348	Combined sources	3
Helixⁱ	354 – 370	Combined sources	17

Show more details

3D structure databases

ProteinModelPortalⁱ	P27600
SMRⁱ	P27600
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P27600

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the G-alpha family. G(12) subfamily.Curated

Phylogenomic databases

eggNOGⁱ	KOG0082 Eukaryota ENOG410XNVQ LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000118851
HOGENOMⁱ	HOG000038729
HOVERGENⁱ	HBG063184
InParanoidⁱ	P27600
KEGG Orthology (KO) More...KOⁱ	K04346
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0NV2
PhylomeDBⁱ	P27600
TreeFamⁱ	TF300673

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00066 G-alpha, 1 hit
Gene3Dⁱ	1.10.400.10, 1 hit
InterProⁱ	View protein in InterPro IPR000469 Gprotein_alpha_12/13 IPR001019 Gprotein_alpha_su IPR011025 GproteinA_insert IPR027417 P-loop_NTPase
PANTHERⁱ	PTHR10218 PTHR10218, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00503 G-alpha, 1 hit
PRINTSⁱ	PR00318 GPROTEINA PR00440 GPROTEINA12
SMARTⁱ	View protein in SMART SM00275 G_alpha, 1 hit
SUPFAMⁱ	SSF47895 SSF47895, 1 hit SSF52540 SSF52540, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show all Align All

P27600-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSGVVRTLSR CLLPAEAGAR ERRAGAARDA EREARRRSRD IDALLARERR 
        60         70         80         90        100
AVRRLVKILL LGAGESGKST FLKQMRIIHG REFDQKALLE FRDTIFDNIL 
       110        120        130        140        150
KGSRVLVDAR DKLGIPWQHS ENEKHGMFLM AFENKAGLPV EPATFQLYVP 
       160        170        180        190        200
ALSALWRDSG IREAFSRRSE FQLGESVKYF LDNLDRIGQL NYFPSKQDIL 
       210        220        230        240        250
LARKATKGIV EHDFVIKKIP FKMVDVGGQR SQRQKWFQCF DGITSILFMV 
       260        270        280        290        300
SSSEYDQVLM EDRRTNRLVE SMNIFETIVN NKLFFNVSII LFLNKMDLLV 
       310        320        330        340        350
EKVKSVSIKK HFPDFKGDPH RLEDVQRYLV QCFDRKRRNR SKPLFHHFTT 
       360        370 
AIDTENIRFV FHAVKDTILQ ENLKDIMLQ

Length:379

Mass (Da):44,095

Last modified:January 23, 2007 - v3

Checksum:ⁱ647C524AD7A0B5E2

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	A0A0G2JG40	A0A0G2JG40_MOUSE		Guanine nucleotide-binding protein ... Guanine nucleotide-binding protein subunit alpha-12	Gna12	316	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M63659 mRNA Translation: AAA37648.1 M57618 mRNA Translation: AAA63302.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS19825.1
PIRⁱ	A41095 C33833
NCBI Reference Sequences More...RefSeqⁱ	NP_034432.1, NM_010302.2
UniGeneⁱ	Mm.370185

Genome annotation databases

Ensemblⁱ	ENSMUST00000000153; ENSMUSP00000000153; ENSMUSG00000000149
GeneIDⁱ	14673
KEGGⁱ	mmu:14673
UCSC genome browser More...UCSCⁱ	uc009aih.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P27600	guanine nucleotide-binding protein subunit alpha-12		MESAU		353	UniRef100_P27600
Guanine nucleotide-binding protein subunit alpha-12		CRIGR		305
Gna12 protein		MOUSE		305
UPI00077DBA2A		PERMB		328
UPI00045486E4		CRIGR		340

Protein	Similar proteins		Species	Score	Length	Source
P27600	Guanine nucleotide-binding protein subunit alpha-12		HUMAN		381	UniRef90_P27600
Guanine nucleotide-binding protein subunit alpha-12		RAT		379
guanine nucleotide-binding protein subunit alpha-12		MESAU		353
Guanine nucleotide-binding protein subunit alpha-12		CRIGR		305
Gna12 protein		MOUSE		305
+70

Protein	Similar proteins		Species	Score	Length	Source
P27600	Guanine nucleotide-binding protein subunit alpha-12		HUMAN		381	UniRef50_P27600
Guanine nucleotide-binding protein subunit alpha-12		RAT		379
guanine nucleotide-binding protein subunit alpha-12		MESAU		353
Guanine nucleotide-binding protein subunit alpha-12		CRIGR		305
Gna12 protein		MOUSE		305
+153

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M63659 mRNA Translation: AAA37648.1 M57618 mRNA Translation: AAA63302.1
CCDSⁱ	CCDS19825.1
PIRⁱ	A41095 C33833
RefSeqⁱ	NP_034432.1, NM_010302.2
UniGeneⁱ	Mm.370185

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1ZCA	X-ray	2.90	A/B	48-379	[»]
ProteinModelPortalⁱ	P27600
SMRⁱ	P27600
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

IntActⁱ	P27600, 3 interactors
MINTⁱ	P27600
STRINGⁱ	10090.ENSMUSP00000000153

PTM databases

iPTMnetⁱ	P27600
PhosphoSitePlusⁱ	P27600
SwissPalmⁱ	P27600

Proteomic databases

MaxQBⁱ	P27600
PaxDbⁱ	P27600
PeptideAtlasⁱ	P27600
PRIDEⁱ	P27600

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000000153; ENSMUSP00000000153; ENSMUSG00000000149
GeneIDⁱ	14673
KEGGⁱ	mmu:14673
UCSCⁱ	uc009aih.1 mouse

Organism-specific databases

CTDⁱ	2768
MGIⁱ	MGI:95767 Gna12

Phylogenomic databases

eggNOGⁱ	KOG0082 Eukaryota ENOG410XNVQ LUCA
GeneTreeⁱ	ENSGT00760000118851
HOGENOMⁱ	HOG000038729
HOVERGENⁱ	HBG063184
InParanoidⁱ	P27600
KOⁱ	K04346
OrthoDBⁱ	EOG091G0NV2
PhylomeDBⁱ	P27600
TreeFamⁱ	TF300673

Enzyme and pathway databases

Reactomeⁱ	R-MMU-416482 G alpha (12/13) signalling events R-MMU-456926 Thrombin signalling through proteinase activated receptors (PARs)

Reactomeⁱ

R-MMU-416482 G alpha (12/13) signalling events
R-MMU-456926 Thrombin signalling through proteinase activated receptors (PARs)

Miscellaneous databases

EvolutionaryTraceⁱ	P27600
Protein Ontology More...PROⁱ	PR:P27600
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000000149 Expressed in 276 organ(s), highest expression level in cardiac ventricle
CleanExⁱ	MM_GNA12
ExpressionAtlasⁱ	P27600 baseline and differential
Genevisibleⁱ	P27600 MM

Family and domain databases

CDDⁱ	cd00066 G-alpha, 1 hit
Gene3Dⁱ	1.10.400.10, 1 hit
InterProⁱ	View protein in InterPro IPR000469 Gprotein_alpha_12/13 IPR001019 Gprotein_alpha_su IPR011025 GproteinA_insert IPR027417 P-loop_NTPase
PANTHERⁱ	PTHR10218 PTHR10218, 1 hit
Pfamⁱ	View protein in Pfam PF00503 G-alpha, 1 hit
PRINTSⁱ	PR00318 GPROTEINA PR00440 GPROTEINA12
SMARTⁱ	View protein in SMART SM00275 G_alpha, 1 hit
SUPFAMⁱ	SSF47895 SSF47895, 1 hit SSF52540 SSF52540, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	GNA12_MOUSE
Accessionⁱ	P27600Primary (citable) accession number: P27600
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 1, 1992
	Last sequence update:	January 23, 2007
	Last modified:	November 7, 2018
	This is version 164 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P27600 (GNA12_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Guanine nucleotide-binding protein subunit alpha-12

Gna12

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Plasma membrane

Other locations

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ