Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 5

Gene

Cd40

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processImmunity

Enzyme and pathway databases

ReactomeiR-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-5668541 TNFR2 non-canonical NF-kB pathway
R-MMU-5676594 TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 5
Alternative name(s):
B-cell surface antigen CD40
Bp50
CD40L receptor
CD_antigen: CD40
Gene namesi
Name:Cd40
Synonyms:Tnfrsf5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:88336 Cd40

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 193ExtracellularSequence analysisAdd BLAST174
Transmembranei194 – 215HelicalSequence analysisAdd BLAST22
Topological domaini216 – 289CytoplasmicSequence analysisAdd BLAST74

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000003456020 – 289Tumor necrosis factor receptor superfamily member 5Add BLAST270

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi26 ↔ 37PROSITE-ProRule annotation
Disulfide bondi38 ↔ 51PROSITE-ProRule annotation
Disulfide bondi41 ↔ 59PROSITE-ProRule annotation
Disulfide bondi62 ↔ 77PROSITE-ProRule annotation
Disulfide bondi83 ↔ 103PROSITE-ProRule annotation
Disulfide bondi105 ↔ 119PROSITE-ProRule annotation
Disulfide bondi111 ↔ 116PROSITE-ProRule annotation
Disulfide bondi125 ↔ 143PROSITE-ProRule annotation
Glycosylationi153N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP27512
PaxDbiP27512
PeptideAtlasiP27512
PRIDEiP27512

PTM databases

iPTMnetiP27512
PhosphoSitePlusiP27512

Expressioni

Gene expression databases

BgeeiENSMUSG00000017652 Expressed in 159 organ(s), highest expression level in spleen
CleanExiMM_CD40
ExpressionAtlasiP27512 baseline and differential
GenevisibleiP27512 MM

Interactioni

Subunit structurei

Monomer and homodimer. Interacts with TRAF1, TRAF2 and TRAF6 (By similarity). Interacts with TRAF3 and TRAF5. Interacts with TRAF6 and MAP3K8; the interaction is required for ERK activation.By similarity3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204251, 18 interactors
CORUMiP27512
DIPiDIP-33295N
ELMiP27512
IntActiP27512, 6 interactors
MINTiP27512
STRINGi10090.ENSMUSP00000017799

Structurei

3D structure databases

ProteinModelPortaliP27512
SMRiP27512
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati25 – 60TNFR-Cys 1Add BLAST36
Repeati61 – 103TNFR-Cys 2Add BLAST43
Repeati104 – 144TNFR-Cys 3Add BLAST41
Repeati145 – 187TNFR-Cys 4Add BLAST43

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IY0H Eukaryota
ENOG4112DB5 LUCA
GeneTreeiENSGT00760000119204
HOVERGENiHBG005117
InParanoidiP27512
KOiK03160
OMAiPGLGVKQ
OrthoDBiEOG091G03XW
PhylomeDBiP27512
TreeFamiTF331157

Family and domain databases

CDDicd13407 TNFRSF5, 1 hit
InterProiView protein in InterPro
IPR001368 TNFR/NGFR_Cys_rich_reg
IPR020435 TNFR_5
IPR034021 TNFRSF5_N
PfamiView protein in Pfam
PF00020 TNFR_c6, 1 hit
PRINTSiPR01922 TNFACTORR5
SMARTiView protein in SMART
SM00208 TNFR, 4 hits
PROSITEiView protein in PROSITE
PS00652 TNFR_NGFR_1, 1 hit
PS50050 TNFR_NGFR_2, 4 hits

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform I (identifier: P27512-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSLPRLCAL WGCLLTAVHL GQCVTCSDKQ YLHDGQCCDL CQPGSRLTSH
60 70 80 90 100
CTALEKTQCH PCDSGEFSAQ WNREIRCHQH RHCEPNQGLR VKKEGTAESD
110 120 130 140 150
TVCTCKEGQH CTSKDCEACA QHTPCIPGFG VMEMATETTD TVCHPCPVGF
160 170 180 190 200
FSNQSSLFEK CYPWTSCEDK NLEVLQKGTS QTNVICGLKS RMRALLVIPV
210 220 230 240 250
VMGILITIFG VFLYIKKVVK KPKDNEILPP AARRQDPQEM EDYPGHNTAA
260 270 280
PVQETLHGCQ PVTQEDGKES RISVQERQVT DSIALRPLV
Length:289
Mass (Da):32,093
Last modified:February 26, 2008 - v3
Checksum:iC7970DAD2FEA534A
GO
Isoform II (identifier: P27512-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-203: SCEDKNLEVL...ALLVIPVVMG → RFKVPDASPA...YQKGGQETKG
     204-289: Missing.

Show »
Length:203
Mass (Da):22,468
Checksum:i0C4C94E7CC426202
GO
Isoform III (identifier: P27512-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-234: KKVVKKPKDNEILPPAARR → SECSGEEREGGFSPVEPAS
     235-289: Missing.

Show »
Length:234
Mass (Da):25,747
Checksum:i00DB1DD38347E325
GO
Isoform IV (identifier: P27512-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-222: KKVVKKP → SGQETKG
     223-289: Missing.

Show »
Length:222
Mass (Da):24,499
Checksum:iEE21E6C76FB42DEF
GO
Isoform V (identifier: P27512-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-216: GLKSRMRALLVIPVVMGILITIFGVFLYIK → E

Show »
Length:260
Mass (Da):28,878
Checksum:i57A37C0E8CF2F142
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2A5L7A2A5L7_MOUSE
Tumor necrosis factor receptor supe...
Cd40
121Annotation score:
S4R2M8S4R2M8_MOUSE
Tumor necrosis factor receptor supe...
Cd40
44Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti21G → W in BAE31440 (PubMed:16141072).Curated1
Sequence conflicti24V → L in CAJ18551 (Ref. 6) Curated1
Sequence conflicti24V → L in AAH29254 (PubMed:15489334).Curated1
Sequence conflicti92K → N in BAE36843 (PubMed:16141072).Curated1
Sequence conflicti104T → A in CAJ18551 (Ref. 6) Curated1
Sequence conflicti104T → A in AAH29254 (PubMed:15489334).Curated1
Sequence conflicti194A → T in BAE29991 (PubMed:16141072).Curated1
Sequence conflicti221K → E in BAE31471 (PubMed:16141072).Curated1
Sequence conflicti227I → M in AAB08705 (PubMed:1370315).Curated1
Sequence conflicti227I → M in AAA37404 (PubMed:1281194).Curated1
Sequence conflicti227I → M in CAC29430 (PubMed:11172023).Curated1
Sequence conflicti227I → M in BAC40978 (PubMed:16141072).Curated1
Sequence conflicti227I → M in BAE33789 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006474166 – 203SCEDK…PVVMG → RFKVPDASPAGHSCRDGHPH HHFRGVSLYQKGGQETKG in isoform II. CuratedAdd BLAST38
Alternative sequenceiVSP_006476187 – 216GLKSR…FLYIK → E in isoform V. CuratedAdd BLAST30
Alternative sequenceiVSP_006475204 – 289Missing in isoform II. CuratedAdd BLAST86
Alternative sequenceiVSP_006477216 – 234KKVVK…PAARR → SECSGEEREGGFSPVEPAS in isoform III. CuratedAdd BLAST19
Alternative sequenceiVSP_006479216 – 222KKVVKKP → SGQETKG in isoform IV. Curated7
Alternative sequenceiVSP_006480223 – 289Missing in isoform IV. CuratedAdd BLAST67
Alternative sequenceiVSP_006478235 – 289Missing in isoform III. CuratedAdd BLAST55

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83312 mRNA Translation: AAB08705.1
M94126
, M94129, M94128, M94127 Genomic DNA Translation: AAA37404.1
AJ401387 mRNA Translation: CAC29427.1
AJ401388 mRNA Translation: CAC29428.1
AJ401389 mRNA Translation: CAC29429.1
AJ401390 mRNA Translation: CAC29430.1
AK089861 mRNA Translation: BAC40978.1
AK150959 mRNA Translation: BAE29991.1
AK152716 mRNA Translation: BAE31440.1
AK152756 mRNA Translation: BAE31471.1
AK152942 mRNA Translation: BAE31613.1
AK156644 mRNA Translation: BAE33789.1
AK161978 mRNA Translation: BAE36663.1
AK162305 mRNA Translation: BAE36843.1
CT010343 mRNA Translation: CAJ18551.1
AL591495, AL591411 Genomic DNA Translation: CAM26470.1
BC029254 mRNA Translation: AAH29254.1
CCDSiCCDS17069.1 [P27512-1]
CCDS17070.1 [P27512-5]
CCDS17071.1 [P27512-2]
PIRiA46476
RefSeqiNP_035741.2, NM_011611.2 [P27512-1]
NP_733803.2, NM_170702.2 [P27512-5]
NP_733804.1, NM_170703.2 [P27512-2]
NP_733805.1, NM_170704.2 [P27512-4]
UniGeneiMm.271833

Genome annotation databases

EnsembliENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652 [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652 [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652 [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652 [P27512-3]
GeneIDi21939
KEGGimmu:21939
UCSCiuc008nwx.1 mouse [P27512-5]
uc008nwy.1 mouse [P27512-1]
uc008nwz.1 mouse [P27512-4]
uc008nxb.1 mouse [P27512-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83312 mRNA Translation: AAB08705.1
M94126
, M94129, M94128, M94127 Genomic DNA Translation: AAA37404.1
AJ401387 mRNA Translation: CAC29427.1
AJ401388 mRNA Translation: CAC29428.1
AJ401389 mRNA Translation: CAC29429.1
AJ401390 mRNA Translation: CAC29430.1
AK089861 mRNA Translation: BAC40978.1
AK150959 mRNA Translation: BAE29991.1
AK152716 mRNA Translation: BAE31440.1
AK152756 mRNA Translation: BAE31471.1
AK152942 mRNA Translation: BAE31613.1
AK156644 mRNA Translation: BAE33789.1
AK161978 mRNA Translation: BAE36663.1
AK162305 mRNA Translation: BAE36843.1
CT010343 mRNA Translation: CAJ18551.1
AL591495, AL591411 Genomic DNA Translation: CAM26470.1
BC029254 mRNA Translation: AAH29254.1
CCDSiCCDS17069.1 [P27512-1]
CCDS17070.1 [P27512-5]
CCDS17071.1 [P27512-2]
PIRiA46476
RefSeqiNP_035741.2, NM_011611.2 [P27512-1]
NP_733803.2, NM_170702.2 [P27512-5]
NP_733804.1, NM_170703.2 [P27512-2]
NP_733805.1, NM_170704.2 [P27512-4]
UniGeneiMm.271833

3D structure databases

ProteinModelPortaliP27512
SMRiP27512
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204251, 18 interactors
CORUMiP27512
DIPiDIP-33295N
ELMiP27512
IntActiP27512, 6 interactors
MINTiP27512
STRINGi10090.ENSMUSP00000017799

PTM databases

iPTMnetiP27512
PhosphoSitePlusiP27512

Proteomic databases

MaxQBiP27512
PaxDbiP27512
PeptideAtlasiP27512
PRIDEiP27512

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652 [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652 [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652 [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652 [P27512-3]
GeneIDi21939
KEGGimmu:21939
UCSCiuc008nwx.1 mouse [P27512-5]
uc008nwy.1 mouse [P27512-1]
uc008nwz.1 mouse [P27512-4]
uc008nxb.1 mouse [P27512-2]

Organism-specific databases

CTDi958
MGIiMGI:88336 Cd40

Phylogenomic databases

eggNOGiENOG410IY0H Eukaryota
ENOG4112DB5 LUCA
GeneTreeiENSGT00760000119204
HOVERGENiHBG005117
InParanoidiP27512
KOiK03160
OMAiPGLGVKQ
OrthoDBiEOG091G03XW
PhylomeDBiP27512
TreeFamiTF331157

Enzyme and pathway databases

ReactomeiR-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-5668541 TNFR2 non-canonical NF-kB pathway
R-MMU-5676594 TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Miscellaneous databases

PROiPR:P27512
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000017652 Expressed in 159 organ(s), highest expression level in spleen
CleanExiMM_CD40
ExpressionAtlasiP27512 baseline and differential
GenevisibleiP27512 MM

Family and domain databases

CDDicd13407 TNFRSF5, 1 hit
InterProiView protein in InterPro
IPR001368 TNFR/NGFR_Cys_rich_reg
IPR020435 TNFR_5
IPR034021 TNFRSF5_N
PfamiView protein in Pfam
PF00020 TNFR_c6, 1 hit
PRINTSiPR01922 TNFACTORR5
SMARTiView protein in SMART
SM00208 TNFR, 4 hits
PROSITEiView protein in PROSITE
PS00652 TNFR_NGFR_1, 1 hit
PS50050 TNFR_NGFR_2, 4 hits
ProtoNetiSearch...

Entry informationi

Entry nameiTNR5_MOUSE
AccessioniPrimary (citable) accession number: P27512
Secondary accession number(s): Q3TS33
, Q3TSL2, Q3U799, Q3U7C9, Q3UBH3, Q542B1, Q8K2X6, Q99NE0, Q99NE1, Q99NE2, Q99NE3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 26, 2008
Last modified: November 7, 2018
This is version 173 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again