Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P27512 (TNR5_MOUSE)

Entry version 185 (07 Oct 2020)
Sequence version 3 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tumor necrosis factor receptor superfamily member 5

Gene

Cd40

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for TNFSF5/CD40LG (By similarity). Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion (PubMed:12881420).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processImmunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-5668541, TNFR2 non-canonical NF-kB pathway
R-MMU-5676594, TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 5
Alternative name(s):
B-cell surface antigen CD40
Bp50
CD40L receptor
CD_antigen: CD40
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cd40
Synonyms:Tnfrsf5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:88336, Cd40

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 193ExtracellularSequence analysisAdd BLAST174
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei194 – 215HelicalSequence analysisAdd BLAST22
Topological domaini216 – 289CytoplasmicSequence analysisAdd BLAST74

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003456020 – 289Tumor necrosis factor receptor superfamily member 5Add BLAST270

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi26 ↔ 37PROSITE-ProRule annotation
Disulfide bondi38 ↔ 51PROSITE-ProRule annotation
Disulfide bondi41 ↔ 59PROSITE-ProRule annotation
Disulfide bondi62 ↔ 77PROSITE-ProRule annotation
Disulfide bondi83 ↔ 103PROSITE-ProRule annotation
Disulfide bondi105 ↔ 119PROSITE-ProRule annotation
Disulfide bondi111 ↔ 116PROSITE-ProRule annotation
Disulfide bondi125 ↔ 143PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi153N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P27512

MaxQB - The MaxQuant DataBase

More...MaxQBi		P27512

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P27512

PeptideAtlas

More...PeptideAtlasi		P27512

PRoteomics IDEntifications database

More...PRIDEi		P27512

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P27512, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P27512

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P27512

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P27512

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000017652, Expressed in spleen and 186 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P27512, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P27512, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer and homodimer.

Interacts with TRAF1, TRAF2 and TRAF6 (By similarity).

Interacts with TRAF3 and TRAF5.

Interacts with TRAF6 and MAP3K8; the interaction is required for ERK activation.

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		204251, 18 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P27512

Database of interacting proteins

More...DIPi		DIP-33295N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P27512

Protein interaction database and analysis system

More...IntActi		P27512, 6 interactors

Molecular INTeraction database

More...MINTi		P27512

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000017799

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P27512, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P27512

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati25 – 60TNFR-Cys 1Add BLAST36
Repeati61 – 103TNFR-Cys 2Add BLAST43
Repeati104 – 144TNFR-Cys 3Add BLAST41
Repeati145 – 187TNFR-Cys 4Add BLAST43

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S5TQ, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161464

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_052667_4_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P27512

KEGG Orthology (KO)

More...KOi		K03160

Identification of Orthologs from Complete Genome Data

More...OMAi		DAVCGFQ

Database of Orthologous Groups

More...OrthoDBi		1038336at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P27512

TreeFam database of animal gene trees

More...TreeFami		TF331157

Family and domain databases

Conserved Domains Database

More...CDDi		cd13407, TNFRSF5, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001368, TNFR/NGFR_Cys_rich_reg
IPR020435, TNFR_5
IPR034021, TNFRSF5_N

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00020, TNFR_c6, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01922, TNFACTORR5

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00208, TNFR, 4 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00652, TNFR_NGFR_1, 1 hit
PS50050, TNFR_NGFR_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform I (identifier: P27512-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSLPRLCAL WGCLLTAVHL GQCVTCSDKQ YLHDGQCCDL CQPGSRLTSH 
        60         70         80         90        100
CTALEKTQCH PCDSGEFSAQ WNREIRCHQH RHCEPNQGLR VKKEGTAESD 
       110        120        130        140        150
TVCTCKEGQH CTSKDCEACA QHTPCIPGFG VMEMATETTD TVCHPCPVGF 
       160        170        180        190        200
FSNQSSLFEK CYPWTSCEDK NLEVLQKGTS QTNVICGLKS RMRALLVIPV 
       210        220        230        240        250
VMGILITIFG VFLYIKKVVK KPKDNEILPP AARRQDPQEM EDYPGHNTAA 
       260        270        280 
PVQETLHGCQ PVTQEDGKES RISVQERQVT DSIALRPLV
Length:289
Mass (Da):32,093
Last modified:February 26, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC7970DAD2FEA534A
GO
Isoform II (identifier: P27512-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-203: SCEDKNLEVL...ALLVIPVVMG → RFKVPDASPA...YQKGGQETKG
     204-289: Missing.

Show »
Length:203
Mass (Da):22,468
Checksum:i0C4C94E7CC426202
GO
Isoform III (identifier: P27512-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-234: KKVVKKPKDNEILPPAARR → SECSGEEREGGFSPVEPAS
     235-289: Missing.

Show »
Length:234
Mass (Da):25,747
Checksum:i00DB1DD38347E325
GO
Isoform IV (identifier: P27512-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-222: KKVVKKP → SGQETKG
     223-289: Missing.

Show »
Length:222
Mass (Da):24,499
Checksum:iEE21E6C76FB42DEF
GO
Isoform V (identifier: P27512-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-216: GLKSRMRALLVIPVVMGILITIFGVFLYIK → E

Show »
Length:260
Mass (Da):28,878
Checksum:i57A37C0E8CF2F142
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2A5L7A2A5L7_MOUSE
Tumor necrosis factor receptor supe...
Cd40
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2M8S4R2M8_MOUSE
Tumor necrosis factor receptor supe...
Cd40
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti21G → W in BAE31440 (PubMed:16141072).Curated1
Sequence conflicti24V → L in CAJ18551 (Ref. 6) Curated1
Sequence conflicti24V → L in AAH29254 (PubMed:15489334).Curated1
Sequence conflicti92K → N in BAE36843 (PubMed:16141072).Curated1
Sequence conflicti104T → A in CAJ18551 (Ref. 6) Curated1
Sequence conflicti104T → A in AAH29254 (PubMed:15489334).Curated1
Sequence conflicti194A → T in BAE29991 (PubMed:16141072).Curated1
Sequence conflicti221K → E in BAE31471 (PubMed:16141072).Curated1
Sequence conflicti227I → M in AAB08705 (PubMed:1370315).Curated1
Sequence conflicti227I → M in AAA37404 (PubMed:1281194).Curated1
Sequence conflicti227I → M in CAC29430 (PubMed:11172023).Curated1
Sequence conflicti227I → M in BAC40978 (PubMed:16141072).Curated1
Sequence conflicti227I → M in BAE33789 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006474166 – 203SCEDK…PVVMG → RFKVPDASPAGHSCRDGHPH HHFRGVSLYQKGGQETKG in isoform II. CuratedAdd BLAST38
Alternative sequenceiVSP_006476187 – 216GLKSR…FLYIK → E in isoform V. CuratedAdd BLAST30
Alternative sequenceiVSP_006475204 – 289Missing in isoform II. CuratedAdd BLAST86
Alternative sequenceiVSP_006477216 – 234KKVVK…PAARR → SECSGEEREGGFSPVEPAS in isoform III. CuratedAdd BLAST19
Alternative sequenceiVSP_006479216 – 222KKVVKKP → SGQETKG in isoform IV. Curated7
Alternative sequenceiVSP_006480223 – 289Missing in isoform IV. CuratedAdd BLAST67
Alternative sequenceiVSP_006478235 – 289Missing in isoform III. CuratedAdd BLAST55

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M83312 mRNA Translation: AAB08705.1
M94126 M94127 Genomic DNA Translation: AAA37404.1
AJ401387 mRNA Translation: CAC29427.1
AJ401388 mRNA Translation: CAC29428.1
AJ401389 mRNA Translation: CAC29429.1
AJ401390 mRNA Translation: CAC29430.1
AK089861 mRNA Translation: BAC40978.1
AK150959 mRNA Translation: BAE29991.1
AK152716 mRNA Translation: BAE31440.1
AK152756 mRNA Translation: BAE31471.1
AK152942 mRNA Translation: BAE31613.1
AK156644 mRNA Translation: BAE33789.1
AK161978 mRNA Translation: BAE36663.1
AK162305 mRNA Translation: BAE36843.1
CT010343 mRNA Translation: CAJ18551.1
AL591411 Genomic DNA No translation available.
AL591495 Genomic DNA No translation available.
BC029254 mRNA Translation: AAH29254.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS17069.1 [P27512-1]
CCDS17070.1 [P27512-5]
CCDS17071.1 [P27512-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A46476

NCBI Reference Sequences

More...RefSeqi		NP_035741.2, NM_011611.2 [P27512-1]
NP_733803.2, NM_170702.2 [P27512-5]
NP_733804.1, NM_170703.2 [P27512-2]
NP_733805.1, NM_170704.2 [P27512-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652 [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652 [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652 [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652 [P27512-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		21939

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:21939

UCSC genome browser

More...UCSCi		uc008nwx.1, mouse [P27512-5]
uc008nwy.1, mouse [P27512-1]
uc008nwz.1, mouse [P27512-4]
uc008nxb.1, mouse [P27512-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83312 mRNA Translation: AAB08705.1
M94126 M94127 Genomic DNA Translation: AAA37404.1
AJ401387 mRNA Translation: CAC29427.1
AJ401388 mRNA Translation: CAC29428.1
AJ401389 mRNA Translation: CAC29429.1
AJ401390 mRNA Translation: CAC29430.1
AK089861 mRNA Translation: BAC40978.1
AK150959 mRNA Translation: BAE29991.1
AK152716 mRNA Translation: BAE31440.1
AK152756 mRNA Translation: BAE31471.1
AK152942 mRNA Translation: BAE31613.1
AK156644 mRNA Translation: BAE33789.1
AK161978 mRNA Translation: BAE36663.1
AK162305 mRNA Translation: BAE36843.1
CT010343 mRNA Translation: CAJ18551.1
AL591411 Genomic DNA No translation available.
AL591495 Genomic DNA No translation available.
BC029254 mRNA Translation: AAH29254.1
CCDSiCCDS17069.1 [P27512-1]
CCDS17070.1 [P27512-5]
CCDS17071.1 [P27512-2]
PIRiA46476
RefSeqiNP_035741.2, NM_011611.2 [P27512-1]
NP_733803.2, NM_170702.2 [P27512-5]
NP_733804.1, NM_170703.2 [P27512-2]
NP_733805.1, NM_170704.2 [P27512-4]

3D structure databases

SMRiP27512
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi204251, 18 interactors
CORUMiP27512
DIPiDIP-33295N
ELMiP27512
IntActiP27512, 6 interactors
MINTiP27512
STRINGi10090.ENSMUSP00000017799

PTM databases

GlyGeniP27512, 1 site
iPTMnetiP27512
PhosphoSitePlusiP27512
SwissPalmiP27512

Proteomic databases

EPDiP27512
MaxQBiP27512
PaxDbiP27512
PeptideAtlasiP27512
PRIDEiP27512

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3736, 2781 antibodies

Genome annotation databases

EnsembliENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652 [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652 [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652 [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652 [P27512-3]
GeneIDi21939
KEGGimmu:21939
UCSCiuc008nwx.1, mouse [P27512-5]
uc008nwy.1, mouse [P27512-1]
uc008nwz.1, mouse [P27512-4]
uc008nxb.1, mouse [P27512-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		958
MGIiMGI:88336, Cd40

Phylogenomic databases

eggNOGiENOG502S5TQ, Eukaryota
GeneTreeiENSGT00940000161464
HOGENOMiCLU_052667_4_0_1
InParanoidiP27512
KOiK03160
OMAiDAVCGFQ
OrthoDBi1038336at2759
PhylomeDBiP27512
TreeFamiTF331157

Enzyme and pathway databases

ReactomeiR-MMU-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-5668541, TNFR2 non-canonical NF-kB pathway
R-MMU-5676594, TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		21939, 0 hits in 22 CRISPR screens

Protein Ontology

More...PROi		PR:P27512
RNActiP27512, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000017652, Expressed in spleen and 186 other tissues
ExpressionAtlasiP27512, baseline and differential
GenevisibleiP27512, MM

Family and domain databases

CDDicd13407, TNFRSF5, 1 hit
InterProiView protein in InterPro
IPR001368, TNFR/NGFR_Cys_rich_reg
IPR020435, TNFR_5
IPR034021, TNFRSF5_N
PfamiView protein in Pfam
PF00020, TNFR_c6, 2 hits
PRINTSiPR01922, TNFACTORR5
SMARTiView protein in SMART
SM00208, TNFR, 4 hits
PROSITEiView protein in PROSITE
PS00652, TNFR_NGFR_1, 1 hit
PS50050, TNFR_NGFR_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNR5_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P27512
Secondary accession number(s): Q3TS33
, Q3TSL2, Q3U799, Q3U7C9, Q3UBH3, Q542B1, Q8K2X6, Q99NE0, Q99NE1, Q99NE2, Q99NE3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 26, 2008
Last modified: October 7, 2020
This is version 185 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again