Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Elongation factor 1-gamma

Gene

EEF1G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probably plays a role in anchoring the complex to other cellular components.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • response to virus Source: UniProtKB
  • translational elongation Source: GO_Central

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionElongation factor
Biological processProtein biosynthesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-156842 Eukaryotic Translation Elongation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Elongation factor 1-gamma
Short name:
EF-1-gamma
Alternative name(s):
eEF-1B gamma
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EEF1G
Synonyms:EF1G
ORF Names:PRO1608
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000254772.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3213 EEF1G

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
130593 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P26641

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1937

Open Targets

More...
OpenTargetsi
ENSG00000254772

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27649

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EEF1G

Domain mapping of disease mutations (DMDM)

More...
DMDMi
119165

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources2 Publications
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002088132 – 437Elongation factor 1-gammaAdd BLAST436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei147N6-acetyllysineCombined sources1
Modified residuei212N6-acetyllysineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki253Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Cross-linki285Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei401N6-acetyllysineBy similarity1
Modified residuei434N6-acetyllysine; alternateCombined sources1
Modified residuei434N6-malonyllysine; alternate1 Publication1

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P26641

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P26641

PeptideAtlas

More...
PeptideAtlasi
P26641

PRoteomics IDEntifications database

More...
PRIDEi
P26641

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54359

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P26641-1 [P26641-1]

2D gel databases

USC-OGP 2-DE database

More...
OGPi
P26641

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P26641

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P26641

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P26641

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver.

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated in response to enterovirus 71 (EV71) infection.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000254772 Expressed in 89 organ(s), highest expression level in muscle of leg

CleanEx database of gene expression profiles

More...
CleanExi
HS_EEF1G

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P26641 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P26641 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040688
HPA055316

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

EF-1 is composed of four subunits: alpha, beta, delta, and gamma.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108257, 186 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P26641

Database of interacting proteins

More...
DIPi
DIP-32516N

Protein interaction database and analysis system

More...
IntActi
P26641, 161 interactors

Molecular INTeraction database

More...
MINTi
P26641

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000331901

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1437
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P26641

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P26641

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P26641

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2 – 87GST N-terminalAdd BLAST86
Domaini88 – 216GST C-terminalAdd BLAST129
Domaini276 – 437EF-1-gamma C-terminalPROSITE-ProRule annotationAdd BLAST162

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0867 Eukaryota
KOG1627 Eukaryota
COG0625 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007552

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000235245

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051444

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P26641

KEGG Orthology (KO)

More...
KOi
K03233

Identification of Orthologs from Complete Genome Data

More...
OMAi
DYEVYDW

Database of Orthologous Groups

More...
OrthoDBi
EOG091G06QR

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P26641

TreeFam database of animal gene trees

More...
TreeFami
TF314343

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.1010, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001662 EF1B_G_C
IPR036433 EF1B_G_C_sf
IPR010987 Glutathione-S-Trfase_C-like
IPR036282 Glutathione-S-Trfase_C_sf
IPR040079 Glutathione_S-Trfase
IPR004045 Glutathione_S-Trfase_N
IPR004046 GST_C
IPR036249 Thioredoxin-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00647 EF1G, 1 hit
PF00043 GST_C, 1 hit
PF02798 GST_N, 1 hit

Structure-Function Linkage Database

More...
SFLDi
SFLDS00019 Glutathione_Transferase_(cytos, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01183 EF1G, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47616 SSF47616, 1 hit
SSF52833 SSF52833, 1 hit
SSF89942 SSF89942, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50040 EF1G_C, 1 hit
PS50405 GST_CTER, 1 hit
PS50404 GST_NTER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P26641-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAGTLYTYP ENWRAFKALI AAQYSGAQVR VLSAPPHFHF GQTNRTPEFL
60 70 80 90 100
RKFPAGKVPA FEGDDGFCVF ESNAIAYYVS NEELRGSTPE AAAQVVQWVS
110 120 130 140 150
FADSDIVPPA STWVFPTLGI MHHNKQATEN AKEEVRRILG LLDAYLKTRT
160 170 180 190 200
FLVGERVTLA DITVVCTLLW LYKQVLEPSF RQAFPNTNRW FLTCINQPQF
210 220 230 240 250
RAVLGEVKLC EKMAQFDAKK FAETQPKKDT PRKEKGSREE KQKPQAERKE
260 270 280 290 300
EKKAAAPAPE EEMDECEQAL AAEPKAKDPF AHLPKSTFVL DEFKRKYSNE
310 320 330 340 350
DTLSVALPYF WEHFDKDGWS LWYSEYRFPE ELTQTFMSCN LITGMFQRLD
360 370 380 390 400
KLRKNAFASV ILFGTNNSSS ISGVWVFRGQ ELAFPLSPDW QVDYESYTWR
410 420 430
KLDPGSEETQ TLVREYFSWE GAFQHVGKAF NQGKIFK
Length:437
Mass (Da):50,119
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA6110663110CF3FC
GO
Isoform 2 (identifier: P26641-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MAAG → MAERWVAPAVLRRARFASTFFLSPQIYAHKDGDLRSAFFILSFKRGEFIPFLNW

Note: No experimental confirmation available.
Show »
Length:487
Mass (Da):56,150
Checksum:i3FF3FDCBDAFE1A4C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti102A → V in AAH13918 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0562041 – 4MAAG → MAERWVAPAVLRRARFASTF FLSPQIYAHKDGDLRSAFFI LSFKRGEFIPFLNW in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X63526 mRNA Translation: CAA45089.1
Z11531 mRNA Translation: CAA77630.1
AK300203 mRNA Translation: BAG61974.1
AP001363 Genomic DNA No translation available.
AP002990 Genomic DNA No translation available.
BC000384 mRNA Translation: AAH00384.1
BC006509 mRNA Translation: AAH06509.1
BC006520 mRNA Translation: AAH06520.1
BC007949 mRNA Translation: AAH07949.2
BC009865 mRNA Translation: AAH09865.1
BC013918 mRNA Translation: AAH13918.1
BC015813 mRNA Translation: AAH15813.1
BC021974 mRNA Translation: AAH21974.2
BC028179 mRNA Translation: AAH28179.1
BC031012 mRNA Translation: AAH31012.1
BC067738 mRNA Translation: AAH67738.1
M55409 mRNA Translation: AAC18414.1
AF119850 mRNA Translation: AAF69604.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44626.1 [P26641-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S22655

NCBI Reference Sequences

More...
RefSeqi
NP_001395.1, NM_001404.4 [P26641-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.144835
Hs.444467

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329251; ENSP00000331901; ENSG00000254772 [P26641-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1937

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1937

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63526 mRNA Translation: CAA45089.1
Z11531 mRNA Translation: CAA77630.1
AK300203 mRNA Translation: BAG61974.1
AP001363 Genomic DNA No translation available.
AP002990 Genomic DNA No translation available.
BC000384 mRNA Translation: AAH00384.1
BC006509 mRNA Translation: AAH06509.1
BC006520 mRNA Translation: AAH06520.1
BC007949 mRNA Translation: AAH07949.2
BC009865 mRNA Translation: AAH09865.1
BC013918 mRNA Translation: AAH13918.1
BC015813 mRNA Translation: AAH15813.1
BC021974 mRNA Translation: AAH21974.2
BC028179 mRNA Translation: AAH28179.1
BC031012 mRNA Translation: AAH31012.1
BC067738 mRNA Translation: AAH67738.1
M55409 mRNA Translation: AAC18414.1
AF119850 mRNA Translation: AAF69604.1
CCDSiCCDS44626.1 [P26641-1]
PIRiS22655
RefSeqiNP_001395.1, NM_001404.4 [P26641-1]
UniGeneiHs.144835
Hs.444467

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PBUNMR-A276-437[»]
5DQSX-ray2.10A2-218[»]
5JPOX-ray2.00A/B/C/D1-218[»]
ProteinModelPortaliP26641
SMRiP26641
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108257, 186 interactors
CORUMiP26641
DIPiDIP-32516N
IntActiP26641, 161 interactors
MINTiP26641
STRINGi9606.ENSP00000331901

PTM databases

iPTMnetiP26641
PhosphoSitePlusiP26641
SwissPalmiP26641

Polymorphism and mutation databases

BioMutaiEEF1G
DMDMi119165

2D gel databases

OGPiP26641

Proteomic databases

EPDiP26641
PaxDbiP26641
PeptideAtlasiP26641
PRIDEiP26641
ProteomicsDBi54359
TopDownProteomicsiP26641-1 [P26641-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1937
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329251; ENSP00000331901; ENSG00000254772 [P26641-1]
GeneIDi1937
KEGGihsa:1937

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1937
DisGeNETi1937
EuPathDBiHostDB:ENSG00000254772.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EEF1G
HGNCiHGNC:3213 EEF1G
HPAiHPA040688
HPA055316
MIMi130593 gene
neXtProtiNX_P26641
OpenTargetsiENSG00000254772
PharmGKBiPA27649

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0867 Eukaryota
KOG1627 Eukaryota
COG0625 LUCA
GeneTreeiENSGT00390000007552
HOGENOMiHOG000235245
HOVERGENiHBG051444
InParanoidiP26641
KOiK03233
OMAiDYEVYDW
OrthoDBiEOG091G06QR
PhylomeDBiP26641
TreeFamiTF314343

Enzyme and pathway databases

ReactomeiR-HSA-156842 Eukaryotic Translation Elongation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
EEF1G human
EvolutionaryTraceiP26641

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
EEF1G

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1937

Protein Ontology

More...
PROi
PR:P26641

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000254772 Expressed in 89 organ(s), highest expression level in muscle of leg
CleanExiHS_EEF1G
ExpressionAtlasiP26641 baseline and differential
GenevisibleiP26641 HS

Family and domain databases

Gene3Di3.30.70.1010, 1 hit
InterProiView protein in InterPro
IPR001662 EF1B_G_C
IPR036433 EF1B_G_C_sf
IPR010987 Glutathione-S-Trfase_C-like
IPR036282 Glutathione-S-Trfase_C_sf
IPR040079 Glutathione_S-Trfase
IPR004045 Glutathione_S-Trfase_N
IPR004046 GST_C
IPR036249 Thioredoxin-like_sf
PfamiView protein in Pfam
PF00647 EF1G, 1 hit
PF00043 GST_C, 1 hit
PF02798 GST_N, 1 hit
SFLDiSFLDS00019 Glutathione_Transferase_(cytos, 1 hit
SMARTiView protein in SMART
SM01183 EF1G, 1 hit
SUPFAMiSSF47616 SSF47616, 1 hit
SSF52833 SSF52833, 1 hit
SSF89942 SSF89942, 1 hit
PROSITEiView protein in PROSITE
PS50040 EF1G_C, 1 hit
PS50405 GST_CTER, 1 hit
PS50404 GST_NTER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEF1G_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P26641
Secondary accession number(s): B4DTG2
, Q6PJ62, Q6PK31, Q96CU2, Q9P196
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: January 23, 2007
Last modified: December 5, 2018
This is version 210 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again