UniProtKB - P26350 (PTMA_MOUSE)

BLAST

>sp|P26350|PTMA_MOUSE Prothymosin alpha OS=Mus musculus OX=10090 GN=Ptma PE=1 SV=2
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEG
GEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQKTEEDD

Align

Format
Add to basket Added to basket
History
Entry version 135 (12 Sep 2018)
Sequence version 2 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Prothymosin alpha

Gene

Ptma

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.

GO - Molecular functionⁱ

activating transcription factor binding Source: Ensembl
histone binding
Source: MGI
Inferred from direct assayⁱ
- 20434447

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

histone exchange
Source: MGI
Inferred from direct assayⁱ
- 20434447

View the complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Prothymosin alpha Cleaved into the following 2 chains: Prothymosin alpha, N-terminally processed Thymosin alpha
Gene namesⁱ	Name:Ptma
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 1

Organism-specific databases

MGIⁱ	MGI:97803 Ptma

Keywords - Cellular componentⁱ

Nucleus

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Length
ChainⁱPRO_0000423256	1 – 111	Prothymosin alphaAdd BLAST	111
Initiator methionineⁱ		Removed; alternateCombined sources1 Publication
ChainⁱPRO_0000299251	2 – 111	Prothymosin alpha, N-terminally processedAdd BLAST	110
PeptideⁱPRO_0000029866	2 – 29	Thymosin alphaAdd BLAST	28

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	1	N-acetylmethionineBy similarity	1
Modified residueⁱ	2	N-acetylserine; in Prothymosin alpha, N-terminally processedCombined sources	1
Modified residueⁱ	2	PhosphoserineBy similarity	1
Modified residueⁱ	8	PhosphothreonineBy similarity	1
Modified residueⁱ	9	PhosphoserineBy similarity	1
Modified residueⁱ	10	PhosphoserineBy similarity	1
Modified residueⁱ	13	PhosphothreonineBy similarity	1
Modified residueⁱ	14	PhosphothreonineBy similarity	1
Modified residueⁱ	15	N6-acetyllysine; alternateCombined sources	1
Modified residueⁱ	15	N6-succinyllysine; alternateCombined sources	1
Modified residueⁱ	102	PhosphothreonineBy similarity	1
Modified residueⁱ	103	N6-acetyllysine; alternateCombined sources	1
Cross-linkⁱ	103	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residueⁱ	107	PhosphothreonineBy similarity	1

Post-translational modificationⁱ

Covalently linked to a small RNA of about 20 nucleotides.

Keywords - PTMⁱ

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	P26350
PaxDbⁱ	P26350
PeptideAtlas More...PeptideAtlasⁱ	P26350
PRIDEⁱ	P26350
TopDownProteomicsⁱ	P26350

PTM databases

iPTMnetⁱ	P26350
PhosphoSitePlusⁱ	P26350

Miscellaneous databases

PMAP-CutDBⁱ	P26350

PMAP-CutDBⁱ

P26350

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000026238 Expressed in 81 organ(s), highest expression level in thymus
CleanExⁱ	MM_PTMA
ExpressionAtlasⁱ	P26350 baseline and differential
Genevisibleⁱ	P26350 MM

Interactionⁱ

GO - Molecular functionⁱ

activating transcription factor binding Source: Ensembl
histone binding
Source: MGI
Inferred from direct assayⁱ
- 20434447

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	202469, 4 interactors
ELMⁱ	P26350
STRINGⁱ	10090.ENSMUSP00000044188

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Turnⁱ	42 – 44	Combined sources		3

Show more details

3D structure databases

ProteinModelPortalⁱ	P26350
SMRⁱ	P26350
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P26350

EvolutionaryTraceⁱ

P26350

Family & Domainsⁱ

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	42 – 101	Asp/Glu-rich (acidic)Add BLAST		60

Sequence similaritiesⁱ

Belongs to the pro/parathymosin family.Curated

Phylogenomic databases

eggNOGⁱ	ENOG410J563 Eukaryota ENOG410ZA5I LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00730000111051
HOVERGENⁱ	HBG078507
InParanoidⁱ	P26350
KEGG Orthology (KO) More...KOⁱ	K13784
OMAⁱ	ANWNDNE
TreeFamⁱ	TF350357

Family and domain databases

InterProⁱ	View protein in InterPro IPR004931 Pro/parathymosin
PANTHERⁱ	PTHR22745 PTHR22745, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF03247 Prothymosin, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.ⁱShow all

P26350-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSDAAVDTSS EITTKDLKEK KEVVEEAENG RDAPANGNAQ NEENGEQEAD 
        60         70         80         90        100
NEVDEEEEEG GEEEEEEEEG DGEEEDGDED EEAEAPTGKR VAEDDEDDDV 
       110 
DTKKQKTEED D

Length:111

Mass (Da):12,254

Last modified:January 23, 2007 - v2

Checksum:ⁱ345FACE953A3E8FA

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation
A0A087WPN6	A0A087WPN6_MOUSE	Prothymosin alpha Prothymosin alpha	Ptma	98	Annotation score:
A0A087WQN2	A0A087WQN2_MOUSE	Prothymosin alpha Prothymosin alpha	Ptma	145	Annotation score:
A0A087WP98	A0A087WP98_MOUSE	Prothymosin alpha Prothymosin alpha (Prothymosin alpha, isoform CRA_c)	Ptma mCG_133549	58	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	106	K → KK AA sequence (PubMed:2226839).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X56135 mRNA Translation: CAA39601.1 AK037980 mRNA Translation: BAC29913.1 AK084218 mRNA Translation: BAC39141.1 AK132003 mRNA Translation: BAE20932.1 AK142076 mRNA Translation: BAE24932.1 AK145650 mRNA Translation: BAE26566.1 AK153953 mRNA Translation: BAE32276.1 BC081453 mRNA Translation: AAH81453.1 BC083135 mRNA Translation: AAH83135.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS35649.1
PIRⁱ	S15073
NCBI Reference Sequences More...RefSeqⁱ	NP_032998.1, NM_008972.2
UniGeneⁱ	Mm.19187

Genome annotation databases

Ensemblⁱ	ENSMUST00000045897; ENSMUSP00000044188; ENSMUSG00000026238
GeneIDⁱ	19231
KEGGⁱ	mmu:19231
UCSC genome browser More...UCSCⁱ	uc007bvp.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P26350	Prothymosin alpha		MOUSE		98	UniRef100_P26350
Prothymosin alpha (Fragment)		Daphnia magna		167
Uncharacterized protein (Fragment)		MOUSE		172
Uncharacterized protein (Fragment)		MOUSE		171
Prothymosin alpha		MOUSE		111

Protein	Similar proteins		Species	Score	Length	Source
P26350	Prothymosin alpha		MOUSE		98	UniRef90_P26350
Prothymosin alpha (Fragment)		Daphnia magna		167
Uncharacterized protein (Fragment)		MOUSE		172
Uncharacterized protein (Fragment)		MOUSE		171
Prothymosin alpha		MOUSE		111
+1

Protein	Similar proteins		Species	Score	Length	Source
P26350	Prothymosin alpha		MOUSE		98	UniRef50_P26350
Prothymosin alpha (Fragment)		Daphnia magna		167
Uncharacterized protein		MYOLU		169
UPI0007A71E5C		MINNA		209
UPI00083C7DA1		RHIBE		170
+7

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X56135 mRNA Translation: CAA39601.1 AK037980 mRNA Translation: BAC29913.1 AK084218 mRNA Translation: BAC39141.1 AK132003 mRNA Translation: BAE20932.1 AK142076 mRNA Translation: BAE24932.1 AK145650 mRNA Translation: BAE26566.1 AK153953 mRNA Translation: BAE32276.1 BC081453 mRNA Translation: AAH81453.1 BC083135 mRNA Translation: AAH83135.1
CCDSⁱ	CCDS35649.1
PIRⁱ	S15073
RefSeqⁱ	NP_032998.1, NM_008972.2
UniGeneⁱ	Mm.19187

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2Z32	X-ray	2.00	B	39-54	[»]
ProteinModelPortalⁱ	P26350
SMRⁱ	P26350
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	202469, 4 interactors
ELMⁱ	P26350
STRINGⁱ	10090.ENSMUSP00000044188

PTM databases

iPTMnetⁱ	P26350
PhosphoSitePlusⁱ	P26350

Proteomic databases

EPDⁱ	P26350
PaxDbⁱ	P26350
PeptideAtlasⁱ	P26350
PRIDEⁱ	P26350
TopDownProteomicsⁱ	P26350

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000045897; ENSMUSP00000044188; ENSMUSG00000026238
GeneIDⁱ	19231
KEGGⁱ	mmu:19231
UCSCⁱ	uc007bvp.1 mouse

Organism-specific databases

CTDⁱ	5757
MGIⁱ	MGI:97803 Ptma

Phylogenomic databases

eggNOGⁱ	ENOG410J563 Eukaryota ENOG410ZA5I LUCA
GeneTreeⁱ	ENSGT00730000111051
HOVERGENⁱ	HBG078507
InParanoidⁱ	P26350
KOⁱ	K13784
OMAⁱ	ANWNDNE
TreeFamⁱ	TF350357

Miscellaneous databases

ChiTaRSⁱ	Ptma mouse
EvolutionaryTraceⁱ	P26350
PMAP-CutDBⁱ	P26350
Protein Ontology More...PROⁱ	PR:P26350
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000026238 Expressed in 81 organ(s), highest expression level in thymus
CleanExⁱ	MM_PTMA
ExpressionAtlasⁱ	P26350 baseline and differential
Genevisibleⁱ	P26350 MM

Family and domain databases

InterProⁱ	View protein in InterPro IPR004931 Pro/parathymosin
PANTHERⁱ	PTHR22745 PTHR22745, 1 hit
Pfamⁱ	View protein in Pfam PF03247 Prothymosin, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PTMA_MOUSE
Accessionⁱ	P26350Primary (citable) accession number: P26350 Secondary accession number(s): Q3UQV6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 1, 1992
	Last sequence update:	January 23, 2007
	Last modified:	September 12, 2018
	This is version 135 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P26350 (PTMA_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Prothymosin alpha

Ptma

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Cytosol

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

Miscellaneous databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Computationally mapped potential isoform sequencesi

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Computationally mapped potential isoform sequencesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ