Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Catenin alpha-2

Gene

CTNNA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCell adhesion, Differentiation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-375170 CDO in myogenesis

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P26232

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Catenin alpha-2
Alternative name(s):
Alpha N-catenin
Alpha-catenin-related protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CTNNA2
Synonyms:CAPR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000066032.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2510 CTNNA2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
114025 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P26232

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1496

Open Targets

More...
OpenTargetsi
ENSG00000066032

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27013

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CTNNA2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
114152793

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000642631 – 953Catenin alpha-2Add BLAST953

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei632PhosphothreonineBy similarity1
Modified residuei640PhosphoserineCombined sources1
Modified residuei651PhosphoserineBy similarity1
Modified residuei901PhosphoserineBy similarity1
Modified residuei939PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P26232

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P26232

PeptideAtlas

More...
PeptideAtlasi
P26232

PRoteomics IDEntifications database

More...
PRIDEi
P26232

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54314
54315 [P26232-2]
54316 [P26232-3]
54317 [P26232-4]
54318 [P26232-5]
54319 [P26232-6]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P26232-6 [P26232-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P26232

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P26232

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P26232

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000066032 Expressed in 136 organ(s), highest expression level in frontal pole

CleanEx database of gene expression profiles

More...
CleanExi
HS_CTNNA2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P26232 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P26232 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB037175

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CDH1 and CDH2 (By similarity). Interacts with ZNF639; recruits CTNNA2 to the nucleus (PubMed:16182284).By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ZNF639Q9UID67EBI-3953920,EBI-947476

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107877, 28 interactors

Database of interacting proteins

More...
DIPi
DIP-60979N

Protein interaction database and analysis system

More...
IntActi
P26232, 8 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P26232

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P26232

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the vinculin/alpha-catenin family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154515

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000069

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P26232

KEGG Orthology (KO)

More...
KOi
K05691

Identification of Orthologs from Complete Genome Data

More...
OMAi
WENQVRI

Database of Orthologous Groups

More...
OrthoDBi
EOG091G01KR

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P26232

TreeFam database of animal gene trees

More...
TreeFami
TF313686

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036723 Alpha-catenin/vinculin-like_sf
IPR001033 Alpha_catenin
IPR030046 CTNNA2
IPR006077 Vinculin/catenin
IPR000633 Vinculin_CS

The PANTHER Classification System

More...
PANTHERi
PTHR18914 PTHR18914, 1 hit
PTHR18914:SF23 PTHR18914:SF23, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01044 Vinculin, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00805 ALPHACATENIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47220 SSF47220, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00663 VINCULIN_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P26232-1) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin II

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSATSPIIL KWDPKSLEIR TLTVERLLEP LVTQVTTLVN TSNKGPSGKK
60 70 80 90 100
KGRSKKAHVL AASVEQATQN FLEKGEQIAK ESQDLKEELV AAVEDVRKQG
110 120 130 140 150
ETMRIASSEF ADDPCSSVKR GTMVRAARAL LSAVTRLLIL ADMADVMRLL
160 170 180 190 200
SHLKIVEEAL EAVKNATNEQ DLANRFKEFG KEMVKLNYVA ARRQQELKDP
210 220 230 240 250
HCRDEMAAAR GALKKNATML YTASQAFLRH PDVAATRANR DYVFKQVQEA
260 270 280 290 300
IAGISNAAQA TSPTDEAKGH TGIGELAAAL NEFDNKIILD PMTFSEARFR
310 320 330 340 350
PSLEERLESI ISGAALMADS SCTRDDRRER IVAECNAVRQ ALQDLLSEYM
360 370 380 390 400
NNTGRKEKGD PLNIAIDKMT KKTRDLRRQL RKAVMDHISD SFLETNVPLL
410 420 430 440 450
VLIEAAKSGN EKEVKEYAQV FREHANKLVE VANLACSISN NEEGVKLVRM
460 470 480 490 500
AATQIDSLCP QVINAALTLA ARPQSKVAQD NMDVFKDQWE KQVRVLTEAV
510 520 530 540 550
DDITSVDDFL SVSENHILED VNKCVIALQE GDVDTLDRTA GAIRGRAARV
560 570 580 590 600
IHIINAEMEN YEAGVYTEKV LEATKLLSET VMPRFAEQVE VAIEALSANV
610 620 630 640 650
PQPFEENEFI DASRLVYDGV RDIRKAVLMI RTPEELEDDS DFEQEDYDVR
660 670 680 690 700
SRTSVQTEDD QLIAGQSARA IMAQLPQEEK AKIAEQVEIF HQEKSKLDAE
710 720 730 740 750
VAKWDDSGND IIVLAKQMCM IMMEMTDFTR GKGPLKNTSD VINAAKKIAE
760 770 780 790 800
AGSRMDKLAR AVADQCPDSA CKQDLLAYLQ RIALYCHQLN ICSKVKAEVQ
810 820 830 840 850
NLGGELIVSG TGVQSTFTTF YEVDCDVIDG GRASQLSTHL PTCAEGAPIG
860 870 880 890 900
SGSSDSSMLD SATSLIQAAK NLMNAVVLTV KASYVASTKY QKVYGTAAVN
910 920 930 940 950
SPVVSWKMKA PEKKPLVKRE KPEEFQTRVR RGSQKKHISP VQALSEFKAM

DSF
Length:953
Mass (Da):105,313
Last modified:January 23, 2007 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5FC88907B37E8A6C
GO
Isoform 2 (identifier: P26232-2) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin I

The sequence of this isoform differs from the canonical sequence as follows:
     811-858: Missing.

Show »
Length:905
Mass (Da):100,447
Checksum:iECDB5DA119B443CF
GO
Isoform 3 (identifier: P26232-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     766-858: Missing.

Note: No experimental confirmation available.
Show »
Length:860
Mass (Da):95,558
Checksum:i33963B324E2787FE
GO
Isoform 4 (identifier: P26232-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-368: Missing.
     811-858: Missing.

Show »
Length:537
Mass (Da):59,868
Checksum:i71B24F41F0B4D6FB
GO
Isoform 5 (identifier: P26232-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM
     811-858: Missing.

Note: No experimental confirmation available.
Show »
Length:939
Mass (Da):104,273
Checksum:i4B4AF75F8A539C5B
GO
Isoform 6 (identifier: P26232-6) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin III

The sequence of this isoform differs from the canonical sequence as follows:
     1-351: Missing.
     352-352: N → MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ
     811-858: Missing.

Show »
Length:584
Mass (Da):65,111
Checksum:iA3A1391C89740337
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B9A010B9A010_HUMAN
Catenin alpha-2
CTNNA2
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRI5A0A0A0MRI5_HUMAN
Catenin alpha-2
CTNNA2
569Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTJ6A0A0A0MTJ6_HUMAN
Catenin alpha-2
CTNNA2
476Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZ88C9IZ88_HUMAN
Catenin alpha-2
CTNNA2
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J144C9J144_HUMAN
Catenin alpha-2
CTNNA2
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8ZZE7B8ZZE7_HUMAN
Catenin alpha-2
CTNNA2
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti122T → A in BAH12003 (PubMed:14702039).Curated1
Sequence conflicti182E → K in AAA58407 (PubMed:8432524).Curated1
Sequence conflicti309S → SS in AAY15008 (PubMed:15815621).Curated1
Sequence conflicti651 – 652SR → RG in AAA58407 (PubMed:8432524).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0380081 – 368Missing in isoform 4. 1 PublicationAdd BLAST368
Alternative sequenceiVSP_0380051 – 351Missing in isoform 6. 1 PublicationAdd BLAST351
Alternative sequenceiVSP_0380071M → MSGLICLQYGLWHGQKIDFG GPRRLLQRNRGEGSM in isoform 5. 1 Publication1
Alternative sequenceiVSP_038006352N → MDGWRRPLQSVGKVCEKNMK TSEMHTMSGAQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_038009766 – 858Missing in isoform 3. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_020337811 – 858Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M94151 mRNA Translation: AAA58407.2
AK127226 mRNA Translation: BAG54457.1
AK295181 mRNA Translation: BAH12003.1
AK295493 mRNA Translation: BAH12088.1
AK303035 mRNA Translation: BAH13884.1
BX537769 mRNA Translation: CAD97832.1
AC008067 Genomic DNA Translation: AAY15073.1
AC010975 Genomic DNA No translation available.
AC011741 Genomic DNA Translation: AAX93241.1
AC011746 Genomic DNA Translation: AAY15008.1
AC016670 Genomic DNA No translation available.
AC016716 Genomic DNA No translation available.
AC093322 Genomic DNA No translation available.
AC096573 Genomic DNA Translation: AAY14758.1
AC096753 Genomic DNA Translation: AAY14763.1
AC104780 Genomic DNA Translation: AAX88946.1
FJ695201 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAW99564.1
CH471053 Genomic DNA Translation: EAW99565.1
BC052996 mRNA Translation: AAH52996.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42703.2 [P26232-2]
CCDS54371.1 [P26232-3]
CCDS62944.1 [P26232-1]
CCDS62945.1 [P26232-6]
CCDS74531.1 [P26232-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A45011

NCBI Reference Sequences

More...
RefSeqi
NP_001158355.1, NM_001164883.1 [P26232-3]
NP_001269526.1, NM_001282597.2 [P26232-1]
NP_001269527.1, NM_001282598.1 [P26232-5]
NP_001269528.1, NM_001282599.1 [P26232-6]
NP_001269529.1, NM_001282600.1 [P26232-4]
NP_001307739.1, NM_001320810.1
NP_004380.2, NM_004389.3 [P26232-2]
XP_011530857.1, XM_011532555.2 [P26232-1]
XP_011530858.1, XM_011532556.2 [P26232-1]
XP_016858892.1, XM_017003403.1 [P26232-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.167368

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343114; ENSP00000341500; ENSG00000066032 [P26232-6]
ENST00000402739; ENSP00000384638; ENSG00000066032 [P26232-1]
ENST00000466387; ENSP00000418191; ENSG00000066032 [P26232-2]
ENST00000496558; ENSP00000419295; ENSG00000066032 [P26232-2]
ENST00000541047; ENSP00000444675; ENSG00000066032 [P26232-4]
ENST00000629316; ENSP00000486160; ENSG00000066032 [P26232-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1496

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1496

UCSC genome browser

More...
UCSCi
uc010yse.3 human [P26232-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M94151 mRNA Translation: AAA58407.2
AK127226 mRNA Translation: BAG54457.1
AK295181 mRNA Translation: BAH12003.1
AK295493 mRNA Translation: BAH12088.1
AK303035 mRNA Translation: BAH13884.1
BX537769 mRNA Translation: CAD97832.1
AC008067 Genomic DNA Translation: AAY15073.1
AC010975 Genomic DNA No translation available.
AC011741 Genomic DNA Translation: AAX93241.1
AC011746 Genomic DNA Translation: AAY15008.1
AC016670 Genomic DNA No translation available.
AC016716 Genomic DNA No translation available.
AC093322 Genomic DNA No translation available.
AC096573 Genomic DNA Translation: AAY14758.1
AC096753 Genomic DNA Translation: AAY14763.1
AC104780 Genomic DNA Translation: AAX88946.1
FJ695201 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAW99564.1
CH471053 Genomic DNA Translation: EAW99565.1
BC052996 mRNA Translation: AAH52996.1
CCDSiCCDS42703.2 [P26232-2]
CCDS54371.1 [P26232-3]
CCDS62944.1 [P26232-1]
CCDS62945.1 [P26232-6]
CCDS74531.1 [P26232-4]
PIRiA45011
RefSeqiNP_001158355.1, NM_001164883.1 [P26232-3]
NP_001269526.1, NM_001282597.2 [P26232-1]
NP_001269527.1, NM_001282598.1 [P26232-5]
NP_001269528.1, NM_001282599.1 [P26232-6]
NP_001269529.1, NM_001282600.1 [P26232-4]
NP_001307739.1, NM_001320810.1
NP_004380.2, NM_004389.3 [P26232-2]
XP_011530857.1, XM_011532555.2 [P26232-1]
XP_011530858.1, XM_011532556.2 [P26232-1]
XP_016858892.1, XM_017003403.1 [P26232-2]
UniGeneiHs.167368

3D structure databases

ProteinModelPortaliP26232
SMRiP26232
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107877, 28 interactors
DIPiDIP-60979N
IntActiP26232, 8 interactors

PTM databases

iPTMnetiP26232
PhosphoSitePlusiP26232
SwissPalmiP26232

Polymorphism and mutation databases

BioMutaiCTNNA2
DMDMi114152793

Proteomic databases

EPDiP26232
MaxQBiP26232
PeptideAtlasiP26232
PRIDEiP26232
ProteomicsDBi54314
54315 [P26232-2]
54316 [P26232-3]
54317 [P26232-4]
54318 [P26232-5]
54319 [P26232-6]
TopDownProteomicsiP26232-6 [P26232-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343114; ENSP00000341500; ENSG00000066032 [P26232-6]
ENST00000402739; ENSP00000384638; ENSG00000066032 [P26232-1]
ENST00000466387; ENSP00000418191; ENSG00000066032 [P26232-2]
ENST00000496558; ENSP00000419295; ENSG00000066032 [P26232-2]
ENST00000541047; ENSP00000444675; ENSG00000066032 [P26232-4]
ENST00000629316; ENSP00000486160; ENSG00000066032 [P26232-3]
GeneIDi1496
KEGGihsa:1496
UCSCiuc010yse.3 human [P26232-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1496
DisGeNETi1496
EuPathDBiHostDB:ENSG00000066032.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CTNNA2
HGNCiHGNC:2510 CTNNA2
HPAiCAB037175
MIMi114025 gene
neXtProtiNX_P26232
OpenTargetsiENSG00000066032
PharmGKBiPA27013

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000154515
HOVERGENiHBG000069
InParanoidiP26232
KOiK05691
OMAiWENQVRI
OrthoDBiEOG091G01KR
PhylomeDBiP26232
TreeFamiTF313686

Enzyme and pathway databases

ReactomeiR-HSA-375170 CDO in myogenesis
SIGNORiP26232

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CTNNA2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1496

Protein Ontology

More...
PROi
PR:P26232

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000066032 Expressed in 136 organ(s), highest expression level in frontal pole
CleanExiHS_CTNNA2
ExpressionAtlasiP26232 baseline and differential
GenevisibleiP26232 HS

Family and domain databases

InterProiView protein in InterPro
IPR036723 Alpha-catenin/vinculin-like_sf
IPR001033 Alpha_catenin
IPR030046 CTNNA2
IPR006077 Vinculin/catenin
IPR000633 Vinculin_CS
PANTHERiPTHR18914 PTHR18914, 1 hit
PTHR18914:SF23 PTHR18914:SF23, 1 hit
PfamiView protein in Pfam
PF01044 Vinculin, 2 hits
PRINTSiPR00805 ALPHACATENIN
SUPFAMiSSF47220 SSF47220, 4 hits
PROSITEiView protein in PROSITE
PS00663 VINCULIN_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCTNA2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P26232
Secondary accession number(s): B3KXE5
, B7Z2W7, B7Z352, B7Z898, Q4ZFW1, Q53R26, Q53R33, Q53T67, Q53T71, Q53TM8, Q7Z3L1, Q7Z3Y0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 23, 2007
Last modified: December 5, 2018
This is version 176 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again