Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-3

Gene

ITGA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi315 – 323Sequence analysis9
Calcium bindingi378 – 386Sequence analysis9
Calcium bindingi439 – 447Sequence analysis9

GO - Molecular functioni

  • collagen binding Source: Ensembl
  • fibronectin binding Source: Ensembl
  • integrin binding Source: Ensembl
  • laminin binding Source: Ensembl
  • metal ion binding Source: UniProtKB-KW
  • protease binding Source: UniProtKB
  • protein domain specific binding Source: Ensembl
  • protein heterodimerization activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionIntegrin, Receptor
Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-210991 Basigin interactions
R-HSA-216083 Integrin cell surface interactions
R-HSA-3000157 Laminin interactions
R-HSA-8874081 MET activates PTK2 signaling
SIGNORiP26006

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
FRP-2
Galactoprotein B3
Short name:
GAPB3
VLA-3 subunit alpha
CD_antigen: CD49c
Cleaved into the following 2 chains:
Gene namesi
Name:ITGA3
Synonyms:MSK18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000005884.17
HGNCiHGNC:6139 ITGA3
MIMi605025 gene
neXtProtiNX_P26006

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini33 – 991ExtracellularSequence analysisAdd BLAST959
Transmembranei992 – 1014HelicalSequence analysisAdd BLAST23
Topological domaini1015 – 1051CytoplasmicSequence analysisAdd BLAST37

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Involvement in diseasei

Interstitial lung disease, nephrotic syndrome, and epidermolysis bullosa, congenital (ILNEB)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA multiorgan disorder characterized by congenital nephrotic syndrome, interstitial lung disease, and epidermolysis bullosa. The respiratory and renal features predominate, and lung involvement accounts for the lethal course of the disease.
See also OMIM:614748
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_077512125G → R in ILNEB. 1 Publication1
Natural variantiVAR_077513274R → Q in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs745505565Ensembl.1
Natural variantiVAR_068808628R → P in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs140781106EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1016C → S: Abolishes palmitoylation. 1 Publication1

Keywords - Diseasei

Disease mutation, Epidermolysis bullosa

Organism-specific databases

DisGeNETi3675
MalaCardsiITGA3
MIMi614748 phenotype
OpenTargetsiENSG00000005884
Orphaneti306504 Junctional epidermolysis bullosa with respiratory and renal involvement
PharmGKBiPA29939

Chemistry databases

ChEMBLiCHEMBL3525
GuidetoPHARMACOLOGYi2442

Polymorphism and mutation databases

BioMutaiITGA3
DMDMi347595830

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 323 PublicationsAdd BLAST32
ChainiPRO_000001623833 – 1051Integrin alpha-3Add BLAST1019
ChainiPRO_000001623933 – 872Integrin alpha-3 heavy chainSequence analysisAdd BLAST840
ChainiPRO_0000016240876 – 1051Integrin alpha-3 light chainSequence analysisAdd BLAST176

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi94 ↔ 1031 Publication
Glycosylationi107N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi140 ↔ 1621 Publication
Disulfide bondi185 ↔ 1971 Publication
Glycosylationi265N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi485 ↔ 490By similarity
Disulfide bondi496 ↔ 550By similarity
Glycosylationi500N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi511N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi573N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi605N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi615 ↔ 6211 Publication
Glycosylationi656N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi694 ↔ 7021 Publication
Glycosylationi697N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi841N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi846 ↔ 904Interchain (between heavy and light chains)1 Publication
Glycosylationi857N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi911 ↔ 9161 Publication
Glycosylationi926N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi935N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi969N-linked (GlcNAc...) asparagineSequence analysis1
Lipidationi1016S-palmitoyl cysteine1 Publication1

Post-translational modificationi

Isoform 1, but not isoform 2, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiP26006
PaxDbiP26006
PeptideAtlasiP26006
PRIDEiP26006
ProteomicsDBi54305
54306 [P26006-1]

PTM databases

GlyConnecti738
iPTMnetiP26006
PhosphoSitePlusiP26006
SwissPalmiP26006
UniCarbKBiP26006

Miscellaneous databases

PMAP-CutDBiP26006

Expressioni

Tissue specificityi

Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is detected only on endothelial vein cells.1 Publication

Gene expression databases

BgeeiENSG00000005884 Expressed in 99 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_ITGA3
ExpressionAtlasiP26006 baseline and differential

Organism-specific databases

HPAiCAB018594
HPA008572

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Interacts with FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane in a collagen-dependent manner.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109882, 17 interactors
ComplexPortaliCPX-1797 Integrin alpha3-beta1 complex
CORUMiP26006
DIPiDIP-140N
IntActiP26006, 7 interactors
MINTiP26006
STRINGi9606.ENSP00000007722

Chemistry databases

BindingDBiP26006

Structurei

3D structure databases

ProteinModelPortaliP26006
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati38 – 103FG-GAP 1PROSITE-ProRule annotationAdd BLAST66
Repeati110 – 171FG-GAP 2PROSITE-ProRule annotationAdd BLAST62
Repeati185 – 235FG-GAP 3PROSITE-ProRule annotationAdd BLAST51
Repeati236 – 292FG-GAP 4PROSITE-ProRule annotationAdd BLAST57
Repeati293 – 354FG-GAP 5PROSITE-ProRule annotationAdd BLAST62
Repeati356 – 411FG-GAP 6PROSITE-ProRule annotationAdd BLAST56
Repeati415 – 477FG-GAP 7PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1015 – 1021Interaction with HPS57

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1017 – 1021GFFKR motif5

Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPB6 Eukaryota
ENOG410ZZD8 LUCA
GeneTreeiENSGT00930000150849
HOGENOMiHOG000015786
HOVERGENiHBG108011
InParanoidiP26006
KOiK06482
OMAiFQKECGQ
OrthoDBiEOG091G012D
TreeFamiTF105391

Family and domain databases

Gene3Di2.130.10.130, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 2 hits
PF08441 Integrin_alpha2, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SUPFAMiSSF69179 SSF69179, 3 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P26006-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGPGPSRAPR APRLMLCALA LMVAAGGCVV SAFNLDTRFL VVKEAGNPGS
60 70 80 90 100
LFGYSVALHR QTERQQRYLL LAGAPRELAV PDGYTNRTGA VYLCPLTAHK
110 120 130 140 150
DDCERMNITV KNDPGHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTQVLWS
160 170 180 190 200
GSEDQRRMVG KCYVRGNDLE LDSSDDWQTY HNEMCNSNTD YLETGMCQLG
210 220 230 240 250
TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK EWDLSEYSYK DPEDQGNLYI
260 270 280 290 300
GYTMQVGSFI LHPKNITIVT GAPRHRHMGA VFLLSQEAGG DLRRRQVLEG
310 320 330 340 350
SQVGAYFGSA IALADLNNDG WQDLLVGAPY YFERKEEVGG AIYVFMNQAG
360 370 380 390 400
TSFPAHPSLL LHGPSGSAFG LSVASIGDIN QDGFQDIAVG APFEGLGKVY
410 420 430 440 450
IYHSSSKGLL RQPQQVIHGE KLGLPGLATF GYSLSGQMDV DENFYPDLLV
460 470 480 490 500
GSLSDHIVLL RARPVINIVH KTLVPRPAVL DPALCTATSC VQVELCFAYN
510 520 530 540 550
QSAGNPNYRR NITLAYTLEA DRDRRPPRLR FAGSESAVFH GFFSMPEMRC
560 570 580 590 600
QKLELLLMDN LRDKLRPIII SMNYSLPLRM PDRPRLGLRS LDAYPILNQA
610 620 630 640 650
QALENHTEVQ FQKECGPDNK CESNLQMRAA FVSEQQQKLS RLQYSRDVRK
660 670 680 690 700
LLLSINVTNT RTSERSGEDA HEALLTLVVP PALLLSSVRP PGACQANETI
710 720 730 740 750
FCELGNPFKR NQRMELLIAF EVIGVTLHTR DLQVQLQLST SSHQDNLWPM
760 770 780 790 800
ILTLLVDYTL QTSLSMVNHR LQSFFGGTVM GESGMKTVED VGSPLKYEFQ
810 820 830 840 850
VGPMGEGLVG LGTLVLGLEW PYEVSNGKWL LYPTEITVHG NGSWPCRPPG
860 870 880 890 900
DLINPLNLTL SDPGDRPSSP QRRRRQLDPG GGQGPPPVTL AAAKKAKSET
910 920 930 940 950
VLTCATGRAH CVWLECPIPD APVVTNVTVK ARVWNSTFIE DYRDFDRVRV
960 970 980 990 1000
NGWATLFLRT SIPTINMENK TTWFSVDIDS ELVEELPAEI ELWLVLVAVG
1010 1020 1030 1040 1050
AGLLLLGLII LLLWKCGFFK RARTRALYEA KRQKAEMKSQ PSETERLTDD

Y
Length:1,051
Mass (Da):116,612
Last modified:September 21, 2011 - v5
Checksum:iEEAFA7778EF17B21
GO
Isoform 2 (identifier: P26006-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-3B

The sequence of this isoform differs from the canonical sequence as follows:
     1017-1051: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKRTRYYQ...TSWQTRDQYY

Show »
Length:1,066
Mass (Da):118,756
Checksum:i18F243887966B8CE
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YA32H0YA32_HUMAN
Integrin alpha-3
ITGA3
84Annotation score:
K7EMU3K7EMU3_HUMAN
Integrin alpha-3
ITGA3
117Annotation score:
D6R9X8D6R9X8_HUMAN
Integrin alpha-3
ITGA3
142Annotation score:
H0YA49H0YA49_HUMAN
Integrin alpha-3
ITGA3
221Annotation score:
K7EQJ2K7EQJ2_HUMAN
Integrin alpha-3
ITGA3
29Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_077512125G → R in ILNEB. 1 Publication1
Natural variantiVAR_055967268I → F. Corresponds to variant dbSNP:rs2230390Ensembl.1
Natural variantiVAR_077513274R → Q in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs745505565Ensembl.1
Natural variantiVAR_068808628R → P in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs140781106EnsemblClinVar.1
Natural variantiVAR_055968719A → T. Corresponds to variant dbSNP:rs2230392Ensembl.1
Natural variantiVAR_055969840G → S. Corresponds to variant dbSNP:rs2301626Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0027211017 – 1051GFFKR…LTDDY → DFFKRTRYYQIMPKYHAVRI REEERYPPPGSTLPTKKHWV TSWQTRDQYY in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M59911 mRNA Translation: AAA36120.1
AK289961 mRNA Translation: BAF82650.1
AC002401 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94645.1
CH471109 Genomic DNA Translation: EAW94646.1
CH471109 Genomic DNA Translation: EAW94647.1
CH471109 Genomic DNA Translation: EAW94648.1
BC136636 mRNA Translation: AAI36637.1
BC144328 mRNA Translation: AAI44329.1
BC150190 mRNA Translation: AAI50191.1
D01038 mRNA Translation: BAA00845.1
CCDSiCCDS11558.1 [P26006-2]
PIRiA40021
RefSeqiNP_002195.1, NM_002204.3 [P26006-2]
UniGeneiHs.265829
Hs.660689

Genome annotation databases

EnsembliENST00000007722; ENSP00000007722; ENSG00000005884 [P26006-1]
ENST00000320031; ENSP00000315190; ENSG00000005884 [P26006-2]
GeneIDi3675
KEGGihsa:3675
UCSCiuc010dbl.4 human [P26006-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M59911 mRNA Translation: AAA36120.1
AK289961 mRNA Translation: BAF82650.1
AC002401 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94645.1
CH471109 Genomic DNA Translation: EAW94646.1
CH471109 Genomic DNA Translation: EAW94647.1
CH471109 Genomic DNA Translation: EAW94648.1
BC136636 mRNA Translation: AAI36637.1
BC144328 mRNA Translation: AAI44329.1
BC150190 mRNA Translation: AAI50191.1
D01038 mRNA Translation: BAA00845.1
CCDSiCCDS11558.1 [P26006-2]
PIRiA40021
RefSeqiNP_002195.1, NM_002204.3 [P26006-2]
UniGeneiHs.265829
Hs.660689

3D structure databases

ProteinModelPortaliP26006
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109882, 17 interactors
ComplexPortaliCPX-1797 Integrin alpha3-beta1 complex
CORUMiP26006
DIPiDIP-140N
IntActiP26006, 7 interactors
MINTiP26006
STRINGi9606.ENSP00000007722

Chemistry databases

BindingDBiP26006
ChEMBLiCHEMBL3525
GuidetoPHARMACOLOGYi2442

PTM databases

GlyConnecti738
iPTMnetiP26006
PhosphoSitePlusiP26006
SwissPalmiP26006
UniCarbKBiP26006

Polymorphism and mutation databases

BioMutaiITGA3
DMDMi347595830

Proteomic databases

EPDiP26006
PaxDbiP26006
PeptideAtlasiP26006
PRIDEiP26006
ProteomicsDBi54305
54306 [P26006-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000007722; ENSP00000007722; ENSG00000005884 [P26006-1]
ENST00000320031; ENSP00000315190; ENSG00000005884 [P26006-2]
GeneIDi3675
KEGGihsa:3675
UCSCiuc010dbl.4 human [P26006-2]

Organism-specific databases

CTDi3675
DisGeNETi3675
EuPathDBiHostDB:ENSG00000005884.17
GeneCardsiITGA3
HGNCiHGNC:6139 ITGA3
HPAiCAB018594
HPA008572
MalaCardsiITGA3
MIMi605025 gene
614748 phenotype
neXtProtiNX_P26006
OpenTargetsiENSG00000005884
Orphaneti306504 Junctional epidermolysis bullosa with respiratory and renal involvement
PharmGKBiPA29939
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPB6 Eukaryota
ENOG410ZZD8 LUCA
GeneTreeiENSGT00930000150849
HOGENOMiHOG000015786
HOVERGENiHBG108011
InParanoidiP26006
KOiK06482
OMAiFQKECGQ
OrthoDBiEOG091G012D
TreeFamiTF105391

Enzyme and pathway databases

ReactomeiR-HSA-210991 Basigin interactions
R-HSA-216083 Integrin cell surface interactions
R-HSA-3000157 Laminin interactions
R-HSA-8874081 MET activates PTK2 signaling
SIGNORiP26006

Miscellaneous databases

ChiTaRSiITGA3 human
GeneWikiiCD49c
GenomeRNAii3675
PMAP-CutDBiP26006
PROiPR:P26006
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000005884 Expressed in 99 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_ITGA3
ExpressionAtlasiP26006 baseline and differential

Family and domain databases

Gene3Di2.130.10.130, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 2 hits
PF08441 Integrin_alpha2, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SUPFAMiSSF69179 SSF69179, 3 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiITA3_HUMAN
AccessioniPrimary (citable) accession number: P26006
Secondary accession number(s): A7E246
, B7ZM80, B9EGQ1, D3DTX4, D3DTX5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: September 21, 2011
Last modified: November 7, 2018
This is version 198 of the entry and version 5 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  6. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again