Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-3

Gene

ITGA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi315 – 323Sequence analysis9
Calcium bindingi378 – 386Sequence analysis9
Calcium bindingi439 – 447Sequence analysis9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • collagen binding Source: Ensembl
  • fibronectin binding Source: Ensembl
  • integrin binding Source: Ensembl
  • laminin binding Source: Ensembl
  • metal ion binding Source: UniProtKB-KW
  • protease binding Source: UniProtKB
  • protein domain specific binding Source: Ensembl
  • protein heterodimerization activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIntegrin, Receptor
Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-210991 Basigin interactions
R-HSA-216083 Integrin cell surface interactions
R-HSA-3000157 Laminin interactions
R-HSA-8874081 MET activates PTK2 signaling

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P26006

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
FRP-2
Galactoprotein B3
Short name:
GAPB3
VLA-3 subunit alpha
CD_antigen: CD49c
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ITGA3
Synonyms:MSK18
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000005884.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6139 ITGA3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605025 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P26006

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini33 – 991ExtracellularSequence analysisAdd BLAST959
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei992 – 1014HelicalSequence analysisAdd BLAST23
Topological domaini1015 – 1051CytoplasmicSequence analysisAdd BLAST37

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Interstitial lung disease, nephrotic syndrome, and epidermolysis bullosa, congenital (ILNEB)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA multiorgan disorder characterized by congenital nephrotic syndrome, interstitial lung disease, and epidermolysis bullosa. The respiratory and renal features predominate, and lung involvement accounts for the lethal course of the disease.
See also OMIM:614748
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_077512125G → R in ILNEB. 1 Publication1
Natural variantiVAR_077513274R → Q in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs745505565Ensembl.1
Natural variantiVAR_068808628R → P in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs140781106EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1016C → S: Abolishes palmitoylation. 1 Publication1

Keywords - Diseasei

Disease mutation, Epidermolysis bullosa

Organism-specific databases

DisGeNET

More...
DisGeNETi
3675

MalaCards human disease database

More...
MalaCardsi
ITGA3
MIMi614748 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000005884

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
306504 Junctional epidermolysis bullosa with respiratory and renal involvement

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29939

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3525

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2442

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ITGA3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
347595830

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 323 PublicationsAdd BLAST32
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001623833 – 1051Integrin alpha-3Add BLAST1019
ChainiPRO_000001623933 – 872Integrin alpha-3 heavy chainSequence analysisAdd BLAST840
ChainiPRO_0000016240876 – 1051Integrin alpha-3 light chainSequence analysisAdd BLAST176

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi94 ↔ 1031 Publication
Glycosylationi107N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi140 ↔ 1621 Publication
Disulfide bondi185 ↔ 1971 Publication
Glycosylationi265N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi485 ↔ 490By similarity
Disulfide bondi496 ↔ 550By similarity
Glycosylationi500N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi511N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi573N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi605N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi615 ↔ 6211 Publication
Glycosylationi656N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi694 ↔ 7021 Publication
Glycosylationi697N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi841N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi846 ↔ 904Interchain (between heavy and light chains)1 Publication
Glycosylationi857N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi911 ↔ 9161 Publication
Glycosylationi926N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi935N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi969N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi1016S-palmitoyl cysteine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 1, but not isoform 2, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P26006

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P26006

PeptideAtlas

More...
PeptideAtlasi
P26006

PRoteomics IDEntifications database

More...
PRIDEi
P26006

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54305
54306 [P26006-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
738

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P26006

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P26006

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P26006

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P26006

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P26006

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is detected only on endothelial vein cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000005884 Expressed in 99 organ(s), highest expression level in adult mammalian kidney

CleanEx database of gene expression profiles

More...
CleanExi
HS_ITGA3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P26006 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018594
HPA008572

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Interacts with FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane in a collagen-dependent manner.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109882, 17 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1797 Integrin alpha3-beta1 complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P26006

Database of interacting proteins

More...
DIPi
DIP-140N

Protein interaction database and analysis system

More...
IntActi
P26006, 7 interactors

Molecular INTeraction database

More...
MINTi
P26006

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000007722

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P26006

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P26006

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati38 – 103FG-GAP 1PROSITE-ProRule annotationAdd BLAST66
Repeati110 – 171FG-GAP 2PROSITE-ProRule annotationAdd BLAST62
Repeati185 – 235FG-GAP 3PROSITE-ProRule annotationAdd BLAST51
Repeati236 – 292FG-GAP 4PROSITE-ProRule annotationAdd BLAST57
Repeati293 – 354FG-GAP 5PROSITE-ProRule annotationAdd BLAST62
Repeati356 – 411FG-GAP 6PROSITE-ProRule annotationAdd BLAST56
Repeati415 – 477FG-GAP 7PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1015 – 1021Interaction with HPS57

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1017 – 1021GFFKR motif5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IPB6 Eukaryota
ENOG410ZZD8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157746

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015786

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108011

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P26006

KEGG Orthology (KO)

More...
KOi
K06482

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQKECGQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G012D

TreeFam database of animal gene trees

More...
TreeFami
TF105391

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.130, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01839 FG-GAP, 2 hits
PF08441 Integrin_alpha2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01185 INTEGRINA

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00191 Int_alpha, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF69179 SSF69179, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P26006-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGPGPSRAPR APRLMLCALA LMVAAGGCVV SAFNLDTRFL VVKEAGNPGS
60 70 80 90 100
LFGYSVALHR QTERQQRYLL LAGAPRELAV PDGYTNRTGA VYLCPLTAHK
110 120 130 140 150
DDCERMNITV KNDPGHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTQVLWS
160 170 180 190 200
GSEDQRRMVG KCYVRGNDLE LDSSDDWQTY HNEMCNSNTD YLETGMCQLG
210 220 230 240 250
TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK EWDLSEYSYK DPEDQGNLYI
260 270 280 290 300
GYTMQVGSFI LHPKNITIVT GAPRHRHMGA VFLLSQEAGG DLRRRQVLEG
310 320 330 340 350
SQVGAYFGSA IALADLNNDG WQDLLVGAPY YFERKEEVGG AIYVFMNQAG
360 370 380 390 400
TSFPAHPSLL LHGPSGSAFG LSVASIGDIN QDGFQDIAVG APFEGLGKVY
410 420 430 440 450
IYHSSSKGLL RQPQQVIHGE KLGLPGLATF GYSLSGQMDV DENFYPDLLV
460 470 480 490 500
GSLSDHIVLL RARPVINIVH KTLVPRPAVL DPALCTATSC VQVELCFAYN
510 520 530 540 550
QSAGNPNYRR NITLAYTLEA DRDRRPPRLR FAGSESAVFH GFFSMPEMRC
560 570 580 590 600
QKLELLLMDN LRDKLRPIII SMNYSLPLRM PDRPRLGLRS LDAYPILNQA
610 620 630 640 650
QALENHTEVQ FQKECGPDNK CESNLQMRAA FVSEQQQKLS RLQYSRDVRK
660 670 680 690 700
LLLSINVTNT RTSERSGEDA HEALLTLVVP PALLLSSVRP PGACQANETI
710 720 730 740 750
FCELGNPFKR NQRMELLIAF EVIGVTLHTR DLQVQLQLST SSHQDNLWPM
760 770 780 790 800
ILTLLVDYTL QTSLSMVNHR LQSFFGGTVM GESGMKTVED VGSPLKYEFQ
810 820 830 840 850
VGPMGEGLVG LGTLVLGLEW PYEVSNGKWL LYPTEITVHG NGSWPCRPPG
860 870 880 890 900
DLINPLNLTL SDPGDRPSSP QRRRRQLDPG GGQGPPPVTL AAAKKAKSET
910 920 930 940 950
VLTCATGRAH CVWLECPIPD APVVTNVTVK ARVWNSTFIE DYRDFDRVRV
960 970 980 990 1000
NGWATLFLRT SIPTINMENK TTWFSVDIDS ELVEELPAEI ELWLVLVAVG
1010 1020 1030 1040 1050
AGLLLLGLII LLLWKCGFFK RARTRALYEA KRQKAEMKSQ PSETERLTDD

Y
Length:1,051
Mass (Da):116,612
Last modified:September 21, 2011 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEEAFA7778EF17B21
GO
Isoform 2 (identifier: P26006-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-3B

The sequence of this isoform differs from the canonical sequence as follows:
     1017-1051: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKRTRYYQ...TSWQTRDQYY

Show »
Length:1,066
Mass (Da):118,756
Checksum:i18F243887966B8CE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YA32H0YA32_HUMAN
Integrin alpha-3
ITGA3
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMU3K7EMU3_HUMAN
Integrin alpha-3
ITGA3
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9X8D6R9X8_HUMAN
Integrin alpha-3
ITGA3
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA49H0YA49_HUMAN
Integrin alpha-3
ITGA3
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQJ2K7EQJ2_HUMAN
Integrin alpha-3
ITGA3
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_077512125G → R in ILNEB. 1 Publication1
Natural variantiVAR_055967268I → F. Corresponds to variant dbSNP:rs2230390Ensembl.1
Natural variantiVAR_077513274R → Q in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs745505565Ensembl.1
Natural variantiVAR_068808628R → P in ILNEB. 1 PublicationCorresponds to variant dbSNP:rs140781106EnsemblClinVar.1
Natural variantiVAR_055968719A → T. Corresponds to variant dbSNP:rs2230392Ensembl.1
Natural variantiVAR_055969840G → S. Corresponds to variant dbSNP:rs2301626Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0027211017 – 1051GFFKR…LTDDY → DFFKRTRYYQIMPKYHAVRI REEERYPPPGSTLPTKKHWV TSWQTRDQYY in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M59911 mRNA Translation: AAA36120.1
AK289961 mRNA Translation: BAF82650.1
AC002401 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94645.1
CH471109 Genomic DNA Translation: EAW94646.1
CH471109 Genomic DNA Translation: EAW94647.1
CH471109 Genomic DNA Translation: EAW94648.1
BC136636 mRNA Translation: AAI36637.1
BC144328 mRNA Translation: AAI44329.1
BC150190 mRNA Translation: AAI50191.1
D01038 mRNA Translation: BAA00845.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11558.1 [P26006-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A40021

NCBI Reference Sequences

More...
RefSeqi
NP_002195.1, NM_002204.3 [P26006-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.265829
Hs.660689

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000007722; ENSP00000007722; ENSG00000005884 [P26006-1]
ENST00000320031; ENSP00000315190; ENSG00000005884 [P26006-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3675

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3675

UCSC genome browser

More...
UCSCi
uc010dbl.4 human [P26006-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M59911 mRNA Translation: AAA36120.1
AK289961 mRNA Translation: BAF82650.1
AC002401 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94645.1
CH471109 Genomic DNA Translation: EAW94646.1
CH471109 Genomic DNA Translation: EAW94647.1
CH471109 Genomic DNA Translation: EAW94648.1
BC136636 mRNA Translation: AAI36637.1
BC144328 mRNA Translation: AAI44329.1
BC150190 mRNA Translation: AAI50191.1
D01038 mRNA Translation: BAA00845.1
CCDSiCCDS11558.1 [P26006-2]
PIRiA40021
RefSeqiNP_002195.1, NM_002204.3 [P26006-2]
UniGeneiHs.265829
Hs.660689

3D structure databases

ProteinModelPortaliP26006
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109882, 17 interactors
ComplexPortaliCPX-1797 Integrin alpha3-beta1 complex
CORUMiP26006
DIPiDIP-140N
IntActiP26006, 7 interactors
MINTiP26006
STRINGi9606.ENSP00000007722

Chemistry databases

BindingDBiP26006
ChEMBLiCHEMBL3525
GuidetoPHARMACOLOGYi2442

PTM databases

GlyConnecti738
iPTMnetiP26006
PhosphoSitePlusiP26006
SwissPalmiP26006
UniCarbKBiP26006

Polymorphism and mutation databases

BioMutaiITGA3
DMDMi347595830

Proteomic databases

EPDiP26006
PaxDbiP26006
PeptideAtlasiP26006
PRIDEiP26006
ProteomicsDBi54305
54306 [P26006-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000007722; ENSP00000007722; ENSG00000005884 [P26006-1]
ENST00000320031; ENSP00000315190; ENSG00000005884 [P26006-2]
GeneIDi3675
KEGGihsa:3675
UCSCiuc010dbl.4 human [P26006-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3675
DisGeNETi3675
EuPathDBiHostDB:ENSG00000005884.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ITGA3
HGNCiHGNC:6139 ITGA3
HPAiCAB018594
HPA008572
MalaCardsiITGA3
MIMi605025 gene
614748 phenotype
neXtProtiNX_P26006
OpenTargetsiENSG00000005884
Orphaneti306504 Junctional epidermolysis bullosa with respiratory and renal involvement
PharmGKBiPA29939

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IPB6 Eukaryota
ENOG410ZZD8 LUCA
GeneTreeiENSGT00940000157746
HOGENOMiHOG000015786
HOVERGENiHBG108011
InParanoidiP26006
KOiK06482
OMAiFQKECGQ
OrthoDBiEOG091G012D
TreeFamiTF105391

Enzyme and pathway databases

ReactomeiR-HSA-210991 Basigin interactions
R-HSA-216083 Integrin cell surface interactions
R-HSA-3000157 Laminin interactions
R-HSA-8874081 MET activates PTK2 signaling
SIGNORiP26006

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ITGA3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CD49c

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3675
PMAP-CutDBiP26006

Protein Ontology

More...
PROi
PR:P26006

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000005884 Expressed in 99 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_ITGA3
ExpressionAtlasiP26006 baseline and differential

Family and domain databases

Gene3Di2.130.10.130, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 2 hits
PF08441 Integrin_alpha2, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SUPFAMiSSF69179 SSF69179, 3 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiITA3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P26006
Secondary accession number(s): A7E246
, B7ZM80, B9EGQ1, D3DTX4, D3DTX5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: September 21, 2011
Last modified: December 5, 2018
This is version 199 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again