Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 192 (17 Jun 2020)
Sequence version 1 (01 May 1992)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rhombotin-2

Gene

LMO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P25791

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rhombotin-2
Alternative name(s):
Cysteine-rich protein TTG-2
LIM domain only protein 2
Short name:
LMO-2
T-cell translocation protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMO2
Synonyms:RBTN2, RBTNL1, RHOM2, TTG2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000135363.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6642 LMO2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
180385 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P25791

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD.

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
4005

Open Targets

More...
OpenTargetsi
ENSG00000135363

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30408

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P25791 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3217402

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LMO2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
132533

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758961 – 158Rhombotin-2Add BLAST158

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P25791

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P25791

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P25791

PeptideAtlas

More...
PeptideAtlasi
P25791

PRoteomics IDEntifications database

More...
PRIDEi
P25791

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
54294 [P25791-1]
54295 [P25791-3]
54296 [P25791-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P25791

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P25791

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135363 Expressed in metanephric glomerulus and 235 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P25791 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000135363 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts via its LIM domains with ELF2 and LDB1.

Also interacts with basic helix-loop-helix protein TAL1/SCL and can assemble in a complex with LMO2 and TAL1/SCL (By similarity).

Interacts with BEX2 and KDM5A.

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

P25791
With#Exp.IntAct
ABI2 [Q9NYB9]5EBI-739696,EBI-743598
ADAMTSL4 - isoform 3 [Q6UY14-3]3EBI-739696,EBI-10173507
AGTRAP [Q6RW13]3EBI-739696,EBI-741181
AIMP2 [Q13155]3EBI-739696,EBI-745226
BANP [Q8N9N5]3EBI-739696,EBI-744695
BLZF1 [Q9H2G9]3EBI-739696,EBI-2548012
C1orf94 [Q6P1W5]3EBI-739696,EBI-946029
CALCOCO2 [Q13137]3EBI-739696,EBI-739580
CBY2 [Q8NA61]3EBI-739696,EBI-741724
CCDC36 [Q8IYA8]3EBI-739696,EBI-8638439
CDX4 [O14627]3EBI-739696,EBI-10181162
CLHC1 [Q8NHS4]3EBI-739696,EBI-10203156
CMTM5 [Q96DZ9]3EBI-739696,EBI-2548702
DBF4B [Q8NFT6]3EBI-739696,EBI-749662
DDIT3 - isoform 2 [P35638-2]3EBI-739696,EBI-10173632
DRAP1 [Q14919]3EBI-739696,EBI-712941
FHL3 [Q13643]3EBI-739696,EBI-741101
GFAP [P14136]3EBI-739696,EBI-744302
GOLGA2 [Q08379]3EBI-739696,EBI-618309
GRB2 [P62993]3EBI-739696,EBI-401755
HNRNPC [P07910]3EBI-739696,EBI-357966
HNRNPM [P52272]4EBI-739696,EBI-486809
HOOK1 [Q9UJC3]3EBI-739696,EBI-746704
IFT43 [Q96FT9]3EBI-739696,EBI-10189681
IKZF3 [Q9UKT9]3EBI-739696,EBI-747204
KANK2 [Q63ZY3]3EBI-739696,EBI-2556193
KRT15 [P19012]3EBI-739696,EBI-739566
KRT40 [Q6A162]3EBI-739696,EBI-10171697
KRTAP10-7 [P60409]3EBI-739696,EBI-10172290
LDB1 [Q86U70]6EBI-739696,EBI-677177
LZTS2 [Q9BRK4]3EBI-739696,EBI-741037
MAGEA8 [P43361]3EBI-739696,EBI-10182930
MAPRE1 [Q15691]6EBI-739696,EBI-1004115
MAPRE2 [Q15555]5EBI-739696,EBI-739717
MAPRE3 [Q9UPY8]5EBI-739696,EBI-726739
MBIP - isoform 4 [Q9NS73-5]3EBI-739696,EBI-10182361
MRFAP1L1 [Q96HT8]3EBI-739696,EBI-748896
MTUS2 [Q5JR59]3EBI-739696,EBI-742948
N4BP2L2 [Q92802]3EBI-739696,EBI-2514973
NIF3L1 [Q9GZT8]3EBI-739696,EBI-740897
NOTCH2NLA [Q7Z3S9]3EBI-739696,EBI-945833
NUP62 [P37198]3EBI-739696,EBI-347978
NUTM1 [Q86Y26]3EBI-739696,EBI-10178410
PDE9A [O76083]3EBI-739696,EBI-742764
PHC2 [Q8IXK0]4EBI-739696,EBI-713786
PRKG1 [Q13976]4EBI-739696,EBI-3952014
REL [Q04864]3EBI-739696,EBI-307352
RELA [Q04206]3EBI-739696,EBI-73886
RINT1 [Q6NUQ1]4EBI-739696,EBI-726876
ROCK1 [Q13464]3EBI-739696,EBI-876651
SAXO1 [Q8IYX7]4EBI-739696,EBI-3957636
SKP1 [P63208]3EBI-739696,EBI-307486
SOX5 [P35711]3EBI-739696,EBI-3505701
SSX2IP [Q9Y2D8]3EBI-739696,EBI-2212028
STAT3 [P40763]3EBI-739696,EBI-518675
TFPT - isoform 2 [P0C1Z6-2]3EBI-739696,EBI-10178002
TLE5 [Q08117]3EBI-739696,EBI-717810
TRIM23 [P36406]3EBI-739696,EBI-740098
TRIM54 [Q9BYV2]3EBI-739696,EBI-2130429
TRIP6 [Q15654]3EBI-739696,EBI-742327
TSC22D4 [Q9Y3Q8]3EBI-739696,EBI-739485
TUFT1 [Q9NNX1]3EBI-739696,EBI-2557363
UBE2I [Q7KZS0]3EBI-739696,EBI-10180829
ZFP64 [Q9NTW7]3EBI-739696,EBI-711679
ZNF24 [P17028]4EBI-739696,EBI-707773
LMO2 - isoform 3 [P25791-3]
With#Exp.IntAct
ABI2 - isoform 2 [Q9NYB9-2]6EBI-11959475,EBI-11096309
ADAMTSL4 - isoform 3 [Q6UY14-3]3EBI-11959475,EBI-10173507
AIMP2 [Q13155]6EBI-11959475,EBI-745226
ARHGEF5 [Q12774]3EBI-11959475,EBI-602199
ARID5A [Q03989]3EBI-11959475,EBI-948603
ARNT2 [A0A087WVE9]3EBI-11959475,EBI-12808086
BCAS2 [O75934]3EBI-11959475,EBI-1050106
BYSL [Q13895]3EBI-11959475,EBI-358049
C1orf109 [Q9NX04]5EBI-11959475,EBI-8643161
CCDC36 [Q8IYA8]3EBI-11959475,EBI-8638439
DMRT3 [Q9NQL9]3EBI-11959475,EBI-9679045
DRAP1 [Q14919]3EBI-11959475,EBI-712941
DYDC1 [Q8WWB3]3EBI-11959475,EBI-740680
EFHC1 [Q5JVL4]3EBI-11959475,EBI-743105
EFHC2 [Q5JST6]3EBI-11959475,EBI-2349927
EIF4EBP1 [Q13541]3EBI-11959475,EBI-74090
ENKD1 [Q9H0I2]3EBI-11959475,EBI-744099
FAAP20 - isoform 4 [Q6NZ36-4]3EBI-11959475,EBI-12013806
FAM214B [Q7L5A3]3EBI-11959475,EBI-745689
FAM228A [Q86W67]3EBI-11959475,EBI-12958227
FAM90A1 [Q86YD7]5EBI-11959475,EBI-6658203
FHL5 [Q5TD97]3EBI-11959475,EBI-750641
GAS8 [O95995]3EBI-11959475,EBI-1052570
GMEB2 [Q9UKD1]6EBI-11959475,EBI-948296
HDAC5 [Q9UQL6]3EBI-11959475,EBI-715576
HNRNPM [P52272]3EBI-11959475,EBI-486809
HOOK1 [Q9UJC3]3EBI-11959475,EBI-746704
ICA1L - isoform 2 [Q8NDH6-2]3EBI-11959475,EBI-12141931
IFT43 - isoform 2 [Q96FT9-2]3EBI-11959475,EBI-11944538
IKZF1 - isoform Ik7 [Q13422-7]3EBI-11959475,EBI-11522367
IKZF3 [Q9UKT9]3EBI-11959475,EBI-747204
INCA1 [Q0VD86]3EBI-11959475,EBI-6509505
ISY1 [Q9ULR0]3EBI-11959475,EBI-2557660
KANK2 [Q63ZY3]3EBI-11959475,EBI-2556193
KAZN - isoform 2 [Q674X7-2]3EBI-11959475,EBI-12024294
KIF2A - isoform 1 [O00139-1]3EBI-11959475,EBI-12197879
KPRP [Q5T749]3EBI-11959475,EBI-10981970
KRT34 [O76011]3EBI-11959475,EBI-1047093
KRT75 [O95678]3EBI-11959475,EBI-2949715
KRT80 - isoform 2 [Q6KB66-2]5EBI-11959475,EBI-11999246
LDB1 - isoform 3 [Q86U70-2]7EBI-11959475,EBI-11979761
LDB2 [O43679]5EBI-11959475,EBI-2865580
LDOC1 [O95751]3EBI-11959475,EBI-740738
itself3EBI-11959475,EBI-11959475
LMO4 [P61968]3EBI-11959475,EBI-2798728
LMOD3 [Q0VAK6]3EBI-11959475,EBI-23685399
LZTS1 [Q9Y250]3EBI-11959475,EBI-1216080
MAPRE1 [Q15691]6EBI-11959475,EBI-1004115
MAPRE2 [Q15555]7EBI-11959475,EBI-739717
MAPRE3 [Q9UPY8]6EBI-11959475,EBI-726739
MISP [Q8IVT2]5EBI-11959475,EBI-2555085
MSN [P26038]3EBI-11959475,EBI-528768
MYOZ3 [Q8TDC0]3EBI-11959475,EBI-5662487
NDOR1 [Q9UHB4]3EBI-11959475,EBI-10249760
NDUFAB1 [O14561]3EBI-11959475,EBI-1246261
NDUFB7 [P17568]3EBI-11959475,EBI-1246238
NFKBID [Q8NI38]3EBI-11959475,EBI-10271199
NOXA1 - isoform 2 [Q86UR1-2]3EBI-11959475,EBI-12025760
NSMF - isoform 2 [Q6X4W1-2]3EBI-11959475,EBI-12028784
PATZ1 - isoform 4 [Q9HBE1-4]3EBI-11959475,EBI-11022007
PAX9 [P55771]3EBI-11959475,EBI-12111000
PBX4 [Q9BYU1]3EBI-11959475,EBI-10302990
POLR2G [P62487]4EBI-11959475,EBI-347928
PPP1R32 - isoform 2 [Q7Z5V6-2]3EBI-11959475,EBI-12000762
PRDM6 [Q9NQX0]3EBI-11959475,EBI-11320284
PRKG1 - isoform Beta [Q13976-2]3EBI-11959475,EBI-4280187
PSMA1 [P25786]3EBI-11959475,EBI-359352
RCN1 [Q15293]3EBI-11959475,EBI-948278
RTL8C [A6ZKI3]3EBI-11959475,EBI-10174072
RUSC1 [Q9BVN2]3EBI-11959475,EBI-6257312
SAXO1 [Q8IYX7]3EBI-11959475,EBI-3957636
SGTB [Q96EQ0]3EBI-11959475,EBI-744081
SMUG1 - isoform 2 [Q53HV7-2]4EBI-11959475,EBI-12275818
SNAPC5 - isoform 2 [O75971-2]3EBI-11959475,EBI-12004298
TBX2 [Q13207]3EBI-11959475,EBI-2853051
TCP10L [Q8TDR4]3EBI-11959475,EBI-3923210
TEKT3 [Q9BXF9]3EBI-11959475,EBI-8644516
TFIP11 [Q9UBB9]3EBI-11959475,EBI-1105213
THAP6 [Q8TBB0]3EBI-11959475,EBI-3925505
TLE5 - isoform 2 [Q08117-2]3EBI-11959475,EBI-11741437
TRIB3 [Q96RU7]3EBI-11959475,EBI-492476
TSC1 [Q86WV8]3EBI-11959475,EBI-12806590
TSEN15 [Q8WW01]3EBI-11959475,EBI-372432
TSEN54 [Q7Z6J9]3EBI-11959475,EBI-2559824
TSGA10IP [Q3SY00]3EBI-11959475,EBI-10241197
TSPYL2 [Q9H2G4]3EBI-11959475,EBI-947459
TSSK3 [Q96PN8]3EBI-11959475,EBI-3918381
UBASH3B [Q8TF42]3EBI-11959475,EBI-1380492
USH1G [Q495M9]3EBI-11959475,EBI-8601749
VBP1 [P61758]3EBI-11959475,EBI-357430
VEZF1 [Q14119]3EBI-11959475,EBI-11980193
VMAC [Q2NL98]3EBI-11959475,EBI-2803134
WASF1 [Q92558]3EBI-11959475,EBI-1548747
WDYHV1 [Q96HA8]3EBI-11959475,EBI-741158
YOD1 [Q5VVQ6]3EBI-11959475,EBI-2510804
ZMYND12 [Q9H0C1]3EBI-11959475,EBI-12030590
ZNF185 [O15231]3EBI-11959475,EBI-6874731
ZNF19 [P17023]3EBI-11959475,EBI-12884200
ZNF24 [P17028]3EBI-11959475,EBI-707773
ZNF250 - isoform 3 [P15622-3]3EBI-11959475,EBI-10177272
ZNF410 - isoform 3 [Q86VK4-3]5EBI-11959475,EBI-11741890
ZNF641 - isoform 2 [Q96N77-2]3EBI-11959475,EBI-12939666
ZNF655 [Q8N720]3EBI-11959475,EBI-625509
ZNF688 [P0C7X2]3EBI-11959475,EBI-4395732

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
110191, 155 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P25791

Protein interaction database and analysis system

More...
IntActi
P25791, 225 interactors

Molecular INTeraction database

More...
MINTi
P25791

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000257818

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P25791 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P25791

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P25791

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini30 – 89LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini94 – 153LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The second LIM zinc-binding domain interacts with KDM5A.

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0490 Eukaryota
ENOG410YIJ3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160199

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_3031687_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P25791

KEGG Orthology (KO)

More...
KOi
K15612

Identification of Orthologs from Complete Genome Data

More...
OMAi
EWTKLNG

Database of Orthologous Groups

More...
OrthoDBi
1307952at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P25791

TreeFam database of animal gene trees

More...
TreeFami
TF351071

Family and domain databases

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...
IDEALi
IID00268

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001781 Znf_LIM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00412 LIM, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132 LIM, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P25791-1) [UniParc]FASTAAdd to basket
Also known as: LMO2a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSAIERKSL DPSEEPVDEV LQIPPSLLTC GGCQQNIGDR YFLKAIDQYW
60 70 80 90 100
HEDCLSCDLC GCRLGEVGRR LYYKLGRKLC RRDYLRLFGQ DGLCASCDKR
110 120 130 140 150
IRAYEMTMRV KDKVYHLECF KCAACQKHFC VGDRYLLINS DIVCEQDIYE

WTKINGMI
Length:158
Mass (Da):18,358
Last modified:May 1, 1992 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1B4FF02505528C93
GO
Isoform 3 (identifier: P25791-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGSAVTVLERGGASSPAERRSKRRRRSGGDGGGGGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPM

Show »
Length:227
Mass (Da):25,036
Checksum:iF80DBD6392880361
GO
Isoform 2 (identifier: P25791-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-15: E → SLKGSQVRCPVWPKTISDPRCWSHSGEAVPDAWPSLQGTSG
     16-158: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:55
Mass (Da):5,941
Checksum:i0576C718F35DABF3
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF98804 differs from that shown. Intron retention.Curated
The sequence AAH73973 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence CAA43430 differs from that shown. Reason: Frameshift.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0389611M → MEGSAVTVLERGGASSPAER RSKRRRRSGGDGGGGGGARA PEGVRAPAAGQPRATKGAPP PPGTPPPSPM in isoform 3. 1 Publication1
Alternative sequenceiVSP_03896215E → SLKGSQVRCPVWPKTISDPR CWSHSGEAVPDAWPSLQGTS G in isoform 2. 1 Publication1
Alternative sequenceiVSP_03896316 – 158Missing in isoform 2. 1 PublicationAdd BLAST143

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X61118 mRNA Translation: CAA43430.1 Frameshift.
BC034041 mRNA Translation: AAH34041.1
BC035607 mRNA Translation: AAH35607.1
BC042426 mRNA Translation: AAH42426.1
BC073973 mRNA Translation: AAH73973.1 Sequence problems.
AF257211 mRNA Translation: AAF98804.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44567.1 [P25791-1]
CCDS7888.2 [P25791-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
S29477

NCBI Reference Sequences

More...
RefSeqi
NP_001135787.1, NM_001142315.1 [P25791-1]
NP_001135788.1, NM_001142316.1 [P25791-1]
NP_005565.2, NM_005574.3 [P25791-3]
XP_005252978.1, XM_005252921.2 [P25791-1]
XP_016873216.1, XM_017017727.1 [P25791-1]
XP_016873217.1, XM_017017728.1 [P25791-1]
XP_016873218.1, XM_017017729.1 [P25791-1]
XP_016873219.1, XM_017017730.1 [P25791-1]
XP_016873220.1, XM_017017731.1 [P25791-1]
XP_016873221.1, XM_017017732.1 [P25791-1]
XP_016873222.1, XM_017017733.1 [P25791-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000257818; ENSP00000257818; ENSG00000135363 [P25791-3]
ENST00000395833; ENSP00000379175; ENSG00000135363 [P25791-1]
ENST00000411482; ENSP00000401967; ENSG00000135363 [P25791-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4005

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4005

UCSC genome browser

More...
UCSCi
uc001mve.5 human [P25791-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X61118 mRNA Translation: CAA43430.1 Frameshift.
BC034041 mRNA Translation: AAH34041.1
BC035607 mRNA Translation: AAH35607.1
BC042426 mRNA Translation: AAH42426.1
BC073973 mRNA Translation: AAH73973.1 Sequence problems.
AF257211 mRNA Translation: AAF98804.1 Sequence problems.
CCDSiCCDS44567.1 [P25791-1]
CCDS7888.2 [P25791-3]
PIRiS29477
RefSeqiNP_001135787.1, NM_001142315.1 [P25791-1]
NP_001135788.1, NM_001142316.1 [P25791-1]
NP_005565.2, NM_005574.3 [P25791-3]
XP_005252978.1, XM_005252921.2 [P25791-1]
XP_016873216.1, XM_017017727.1 [P25791-1]
XP_016873217.1, XM_017017728.1 [P25791-1]
XP_016873218.1, XM_017017729.1 [P25791-1]
XP_016873219.1, XM_017017730.1 [P25791-1]
XP_016873220.1, XM_017017731.1 [P25791-1]
XP_016873221.1, XM_017017732.1 [P25791-1]
XP_016873222.1, XM_017017733.1 [P25791-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2XJYX-ray2.40A26-156[»]
2XJZX-ray2.80A/B/C/D/E26-156[»]
2YPAX-ray2.80C25-156[»]
4KFZX-ray2.80A/B9-158[»]
SMRiP25791
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110191, 155 interactors
CORUMiP25791
IntActiP25791, 225 interactors
MINTiP25791
STRINGi9606.ENSP00000257818

Chemistry databases

ChEMBLiCHEMBL3217402

PTM databases

iPTMnetiP25791
PhosphoSitePlusiP25791

Polymorphism and mutation databases

BioMutaiLMO2
DMDMi132533

Proteomic databases

MassIVEiP25791
MaxQBiP25791
PaxDbiP25791
PeptideAtlasiP25791
PRIDEiP25791
ProteomicsDBi54294 [P25791-1]
54295 [P25791-3]
54296 [P25791-4]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
P25791 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
4265 722 antibodies

The DNASU plasmid repository

More...
DNASUi
4005

Genome annotation databases

EnsembliENST00000257818; ENSP00000257818; ENSG00000135363 [P25791-3]
ENST00000395833; ENSP00000379175; ENSG00000135363 [P25791-1]
ENST00000411482; ENSP00000401967; ENSG00000135363 [P25791-4]
GeneIDi4005
KEGGihsa:4005
UCSCiuc001mve.5 human [P25791-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4005
DisGeNETi4005
EuPathDBiHostDB:ENSG00000135363.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LMO2
HGNCiHGNC:6642 LMO2
HPAiENSG00000135363 Low tissue specificity
MIMi180385 gene
neXtProtiNX_P25791
OpenTargetsiENSG00000135363
PharmGKBiPA30408

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0490 Eukaryota
ENOG410YIJ3 LUCA
GeneTreeiENSGT00940000160199
HOGENOMiCLU_3031687_0_0_1
InParanoidiP25791
KOiK15612
OMAiEWTKLNG
OrthoDBi1307952at2759
PhylomeDBiP25791
TreeFamiTF351071

Enzyme and pathway databases

ReactomeiR-HSA-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs
SIGNORiP25791

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
4005 21 hits in 792 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LMO2 human
EvolutionaryTraceiP25791

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LMO2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4005
PharosiP25791 Tbio

Protein Ontology

More...
PROi
PR:P25791
RNActiP25791 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135363 Expressed in metanephric glomerulus and 235 other tissues
GenevisibleiP25791 HS

Family and domain databases

IDEALiIID00268
InterProiView protein in InterPro
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
SMARTiView protein in SMART
SM00132 LIM, 2 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBTN2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P25791
Secondary accession number(s): Q9HD58
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: May 1, 1992
Last modified: June 17, 2020
This is version 192 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again