Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 193 (05 Jun 2019)
Sequence version 2 (11 Jan 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Bromodomain-containing protein 2

Gene

BRD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in spermatogenesis or folliculogenesis (By similarity). Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator
Biological processHost-virus interaction, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8951936 RUNX3 regulates p14-ARF

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P25440

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bromodomain-containing protein 2
Alternative name(s):
O27.1.1
Really interesting new gene 3 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BRD2
Synonyms:KIAA9001, RING3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1103 BRD2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601540 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P25440

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi78Q → A: Loss of homodimerization. 1 Publication1
Mutagenesisi142 – 143MQ → AA: Loss of homodimerization. 1 Publication2
Mutagenesisi153Y → K: Loss of homodimerization. 1 Publication1
Mutagenesisi154I → A: Partial loss of homodimerization; when associated with A-182. 1 Publication1
Mutagenesisi170E → A: Loss of homodimerization. 1 Publication1
Mutagenesisi174L → E: Loss of homodimerization. 1 Publication1
Mutagenesisi177V → E: Loss of homodimerization. 1 Publication1
Mutagenesisi182Q → A: Partial loss of homodimerization; when associated with A-154. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6046

Open Targets

More...
OpenTargetsi
ENSG00000204256

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25414

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1293289

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1944

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BRD2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12230989

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002111801 – 801Bromodomain-containing protein 2Add BLAST801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei6PhosphothreonineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei301PhosphoserineCombined sources1
Modified residuei305PhosphoserineCombined sources1
Modified residuei633PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P25440

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P25440

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P25440

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P25440

PeptideAtlas

More...
PeptideAtlasi
P25440

PRoteomics IDEntifications database

More...
PRIDEi
P25440

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54271
54272 [P25440-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P25440

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P25440

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204256 Expressed in 234 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P25440 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P25440 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042816

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with E2F1 and with histone H4 acetylated at 'Lys-13'.

2 Publications

(Microbial infection)

Interacts with herpes virus 8 protein LANA1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111973, 55 interactors

Database of interacting proteins

More...
DIPi
DIP-60835N

Protein interaction database and analysis system

More...
IntActi
P25440, 24 interactors

Molecular INTeraction database

More...
MINTi
P25440

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378704

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P25440

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P25440

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P25440

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini91 – 163Bromo 1PROSITE-ProRule annotationAdd BLAST73
Domaini364 – 436Bromo 2PROSITE-ProRule annotationAdd BLAST73
Domaini632 – 714NETPROSITE-ProRule annotationAdd BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi555 – 559Nuclear localization signalSequence analysis5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi61 – 64Poly-Pro4
Compositional biasi476 – 515Glu/Ser-richAdd BLAST40
Compositional biasi492 – 506Poly-GluAdd BLAST15
Compositional biasi544 – 566Arg/Lys-rich (highly basic)Add BLAST23
Compositional biasi551 – 559Poly-Lys9
Compositional biasi634 – 638Poly-Glu5
Compositional biasi775 – 801Ser-richAdd BLAST27
Compositional biasi775 – 793Poly-SerAdd BLAST19

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'.

Keywords - Domaini

Bromodomain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1474 Eukaryota
COG5076 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153385

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231200

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P25440

KEGG Orthology (KO)

More...
KOi
K08871

Identification of Orthologs from Complete Genome Data

More...
OMAi
ESKPMTY

Database of Orthologous Groups

More...
OrthoDBi
1094764at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P25440

TreeFam database of animal gene trees

More...
TreeFami
TF317345

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.220, 1 hit
1.20.920.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR018359 Bromodomain_CS
IPR027353 NET_dom
IPR038336 NET_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17035 BET, 1 hit
PF00439 Bromodomain, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00503 BROMODOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00297 BROMO, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47370 SSF47370, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00633 BROMODOMAIN_1, 2 hits
PS50014 BROMODOMAIN_2, 2 hits
PS51525 NET, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P25440-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQNVTPHNK LPGEGNAGLL GLGPEAAAPG KRIRKPSLLY EGFESPTMAS
60 70 80 90 100
VPALQLTPAN PPPPEVSNPK KPGRVTNQLQ YLHKVVMKAL WKHQFAWPFR
110 120 130 140 150
QPVDAVKLGL PDYHKIIKQP MDMGTIKRRL ENNYYWAASE CMQDFNTMFT
160 170 180 190 200
NCYIYNKPTD DIVLMAQTLE KIFLQKVASM PQEEQELVVT IPKNSHKKGA
210 220 230 240 250
KLAALQGSVT SAHQVPAVSS VSHTALYTPP PEIPTTVLNI PHPSVISSPL
260 270 280 290 300
LKSLHSAGPP LLAVTAAPPA QPLAKKKGVK RKADTTTPTP TAILAPGSPA
310 320 330 340 350
SPPGSLEPKA ARLPPMRRES GRPIKPPRKD LPDSQQQHQS SKKGKLSEQL
360 370 380 390 400
KHCNGILKEL LSKKHAAYAW PFYKPVDASA LGLHDYHDII KHPMDLSTVK
410 420 430 440 450
RKMENRDYRD AQEFAADVRL MFSNCYKYNP PDHDVVAMAR KLQDVFEFRY
460 470 480 490 500
AKMPDEPLEP GPLPVSTAMP PGLAKSSSES SSEESSSESS SEEEEEEDEE
510 520 530 540 550
DEEEEESESS DSEEERAHRL AELQEQLRAV HEQLAALSQG PISKPKRKRE
560 570 580 590 600
KKEKKKKRKA EKHRGRAGAD EDDKGPRAPR PPQPKKSKKA SGSGGGSAAL
610 620 630 640 650
GPSGFGPSGG SGTKLPKKAT KTAPPALPTG YDSEEEEESR PMSYDEKRQL
660 670 680 690 700
SLDINKLPGE KLGRVVHIIQ AREPSLRDSN PEEIEIDFET LKPSTLRELE
710 720 730 740 750
RYVLSCLRKK PRKPYTIKKP VGKTKEELAL EKKRELEKRL QDVSGQLNST
760 770 780 790 800
KKPPKKANEK TESSSAQQVA VSRLSASSSS SDSSSSSSSS SSSDTSDSDS

G
Length:801
Mass (Da):88,061
Last modified:January 11, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9A075EEB13507D8E
GO
Isoform 2 (identifier: P25440-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     615-615: L → LQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRL

Note: No experimental confirmation available.
Show »
Length:836
Mass (Da):92,033
Checksum:i9064FEB42F773B84
GO
Isoform 3 (identifier: P25440-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.

Show »
Length:754
Mass (Da):83,151
Checksum:i2DC450BD2727B979
GO
Isoform 4 (identifier: P25440-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: Missing.

Show »
Length:681
Mass (Da):74,881
Checksum:i22CE98AEC0994F92
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
U3KQA6U3KQA6_HUMAN
Bromodomain-containing protein 2
BRD2
552Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6K2H0Y6K2_HUMAN
Bromodomain-containing protein 2
BRD2
807Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y799H0Y799_HUMAN
Bromodomain-containing protein 2
BRD2
296Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KPW0U3KPW0_HUMAN
Bromodomain-containing protein 2
BRD2
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIQ3E9PIQ3_HUMAN
Bromodomain-containing protein 2
BRD2
401Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDJ7H0YDJ7_HUMAN
Bromodomain-containing protein 2
BRD2
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JK44A0A0G2JK44_HUMAN
Bromodomain-containing protein 2
BRD2
836Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T9V2A0A140T9V2_HUMAN
Bromodomain-containing protein 2
BRD2
648Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T9F7A0A140T9F7_HUMAN
Bromodomain-containing protein 2
BRD2
619Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T9E9A0A140T9E9_HUMAN
Bromodomain-containing protein 2
BRD2
807Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA68890 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti490S → F in CAH56179 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04190430G → E in a glioblastoma multiforme sample; somatic mutation. 1 Publication1
Natural variantiVAR_04190549A → G1 PublicationCorresponds to variant dbSNP:rs3918144Ensembl.1
Natural variantiVAR_04190649A → S1 PublicationCorresponds to variant dbSNP:rs55669504Ensembl.1
Natural variantiVAR_041907212A → P1 PublicationCorresponds to variant dbSNP:rs35952031Ensembl.1
Natural variantiVAR_022132238L → F2 PublicationsCorresponds to variant dbSNP:rs176250Ensembl.1
Natural variantiVAR_041908260P → Q1 PublicationCorresponds to variant dbSNP:rs35294809Ensembl.1
Natural variantiVAR_029300474A → V1 PublicationCorresponds to variant dbSNP:rs3918143Ensembl.1
Natural variantiVAR_029301547R → K. Corresponds to variant dbSNP:rs1049369Ensembl.1
Natural variantiVAR_041909558R → G in a gastric adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_041910569A → T1 PublicationCorresponds to variant dbSNP:rs34530779Ensembl.1
Natural variantiVAR_041911599A → P1 PublicationCorresponds to variant dbSNP:rs55952113Ensembl.1
Natural variantiVAR_041912714P → L in a glioblastoma multiforme sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0550281 – 120Missing in isoform 4. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_0550291 – 47Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_022600615L → LQAGVQWRDLGLLQPPLLGF KRFSCLSLPSSQDYRL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X62083 mRNA Translation: CAA43996.1
M80613 mRNA Translation: AAA68890.1 Different initiation.
X96670 Genomic DNA Translation: CAA65450.1
Z96104 Genomic DNA Translation: CAC69989.1
D42040 mRNA Translation: BAA07641.1
BX647233 mRNA Translation: CAH56179.1
BX648109 mRNA Translation: CAH56171.1
AL832722 mRNA Translation: CAH56208.1
AL645941 Genomic DNA No translation available.
AL662845 Genomic DNA No translation available.
AL805913 Genomic DNA No translation available.
BX005422 Genomic DNA No translation available.
BX908719 Genomic DNA No translation available.
CR936909 Genomic DNA No translation available.
AL935042 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03662.1
CH471081 Genomic DNA Translation: EAX03663.1
BC063840 mRNA Translation: AAH63840.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4762.1 [P25440-1]
CCDS56420.1 [P25440-2]
CCDS56421.1 [P25440-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A56619

NCBI Reference Sequences

More...
RefSeqi
NP_001106653.1, NM_001113182.2 [P25440-1]
NP_001186384.1, NM_001199455.1 [P25440-2]
NP_001186385.1, NM_001199456.1 [P25440-3]
NP_001278915.1, NM_001291986.1 [P25440-4]
NP_005095.1, NM_005104.3 [P25440-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374825; ENSP00000363958; ENSG00000204256 [P25440-1]
ENST00000374831; ENSP00000363964; ENSG00000204256 [P25440-1]
ENST00000383108; ENSP00000372588; ENSG00000234507 [P25440-1]
ENST00000395287; ENSP00000378702; ENSG00000204256 [P25440-2]
ENST00000399527; ENSP00000382443; ENSG00000215077 [P25440-2]
ENST00000399528; ENSP00000382444; ENSG00000215077 [P25440-1]
ENST00000399529; ENSP00000382445; ENSG00000215077 [P25440-1]
ENST00000414731; ENSP00000391246; ENSG00000234704
ENST00000436979; ENSP00000405634; ENSG00000235307 [P25440-3]
ENST00000438194; ENSP00000401791; ENSG00000234507 [P25440-1]
ENST00000442863; ENSP00000410994; ENSG00000234507 [P25440-2]
ENST00000448067; ENSP00000412885; ENSG00000235307 [P25440-2]
ENST00000449085; ENSP00000409145; ENSG00000204256 [P25440-3]
ENST00000449118; ENSP00000399009; ENSG00000234704
ENST00000549126; ENSP00000449380; ENSG00000235307 [P25440-1]
ENST00000552587; ENSP00000449609; ENSG00000235307 [P25440-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6046

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6046

UCSC genome browser

More...
UCSCi
uc003ocn.4 human [P25440-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X62083 mRNA Translation: CAA43996.1
M80613 mRNA Translation: AAA68890.1 Different initiation.
X96670 Genomic DNA Translation: CAA65450.1
Z96104 Genomic DNA Translation: CAC69989.1
D42040 mRNA Translation: BAA07641.1
BX647233 mRNA Translation: CAH56179.1
BX648109 mRNA Translation: CAH56171.1
AL832722 mRNA Translation: CAH56208.1
AL645941 Genomic DNA No translation available.
AL662845 Genomic DNA No translation available.
AL805913 Genomic DNA No translation available.
BX005422 Genomic DNA No translation available.
BX908719 Genomic DNA No translation available.
CR936909 Genomic DNA No translation available.
AL935042 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03662.1
CH471081 Genomic DNA Translation: EAX03663.1
BC063840 mRNA Translation: AAH63840.1
CCDSiCCDS4762.1 [P25440-1]
CCDS56420.1 [P25440-2]
CCDS56421.1 [P25440-3]
PIRiA56619
RefSeqiNP_001106653.1, NM_001113182.2 [P25440-1]
NP_001186384.1, NM_001199455.1 [P25440-2]
NP_001186385.1, NM_001199456.1 [P25440-3]
NP_001278915.1, NM_001291986.1 [P25440-4]
NP_005095.1, NM_005104.3 [P25440-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X0JX-ray1.80A/B/C73-194[»]
2DVQX-ray2.04A/B/C73-194[»]
2DVRX-ray2.30A/B/C73-194[»]
2DVSX-ray2.04A/B/C73-194[»]
2DVVX-ray1.80A348-455[»]
2E3KX-ray2.30A/B/C/D348-455[»]
2G4ANMR-A348-455[»]
2YDWX-ray1.90A/B/C67-200[»]
2YEKX-ray1.98A/B/C67-200[»]
3AQAX-ray2.30A/B/C73-194[»]
3ONIX-ray1.61A344-455[»]
4A9EX-ray1.91A/B/C67-200[»]
4A9FX-ray1.73A/B/C67-200[»]
4A9HX-ray2.05A/B/C67-200[»]
4A9IX-ray2.25A/B/C67-200[»]
4A9JX-ray1.90A/B/C67-200[»]
4A9MX-ray2.06A/B/C67-200[»]
4A9NX-ray1.85A/B/C67-200[»]
4A9OX-ray1.78A/B/C67-200[»]
4AKNX-ray1.82A/B/C67-200[»]
4ALGX-ray1.60A67-200[»]
4ALHX-ray1.78A/B/C67-200[»]
4J1PX-ray1.08A344-455[»]
4MR5X-ray1.63A344-455[»]
4MR6X-ray1.67A344-455[»]
4QEUX-ray1.50A344-455[»]
4QEVX-ray1.80A344-455[»]
4QEWX-ray1.70A344-455[»]
4UYFX-ray1.60A/B/C67-200[»]
4UYGX-ray2.50A/B/C/D/E/F338-473[»]
4UYHX-ray1.73A/B/C67-200[»]
5BT5X-ray1.40A344-455[»]
5DFBX-ray1.40A344-455[»]
5DFCX-ray1.50A344-455[»]
5DFDX-ray1.50A344-455[»]
5DW1X-ray1.55A/B/C/D345-455[»]
5EK9X-ray2.08A/B344-455[»]
5HELX-ray1.45A71-194[»]
5HEMX-ray1.65A/B71-194[»]
5HENX-ray1.79A/B/C71-194[»]
5HFQX-ray1.40A344-455[»]
5IBNX-ray0.94A348-455[»]
5IG6X-ray0.91A348-454[»]
5N2LX-ray1.89A/B/C/D344-455[»]
5O38X-ray1.20A344-455[»]
5O39X-ray1.74A344-455[»]
5O3AX-ray2.40A344-455[»]
5O3BX-ray1.95A/B/C/D344-455[»]
5O3CX-ray1.60A344-455[»]
5O3DX-ray1.60A345-455[»]
5O3EX-ray1.40A344-455[»]
5O3FX-ray1.75A344-455[»]
5O3GX-ray1.85A/B344-455[»]
5O3HX-ray1.40A344-455[»]
5O3IX-ray1.20A344-455[»]
5U5SNMR-A344-455[»]
5U6VX-ray1.77A347-455[»]
5UEWX-ray1.83A/B347-454[»]
5XHEX-ray1.40A348-455[»]
5XHKX-ray1.28A348-455[»]
6CUINMR-A621-750[»]
6FFEX-ray1.76A344-455[»]
6FFFX-ray1.67A344-455[»]
6FFGX-ray1.59A344-455[»]
6MO7X-ray1.85A/B/C71-194[»]
6MO8X-ray1.80A/B/C71-194[»]
6MO9X-ray1.80A/B/C71-194[»]
6MOAX-ray1.27A346-455[»]
SMRiP25440
ModBaseiSearch...

Protein-protein interaction databases

BioGridi111973, 55 interactors
DIPiDIP-60835N
IntActiP25440, 24 interactors
MINTiP25440
STRINGi9606.ENSP00000378704

Chemistry databases

BindingDBiP25440
ChEMBLiCHEMBL1293289
GuidetoPHARMACOLOGYi1944

PTM databases

iPTMnetiP25440
PhosphoSitePlusiP25440

Polymorphism and mutation databases

BioMutaiBRD2
DMDMi12230989

Proteomic databases

EPDiP25440
jPOSTiP25440
MaxQBiP25440
PaxDbiP25440
PeptideAtlasiP25440
PRIDEiP25440
ProteomicsDBi54271
54272 [P25440-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6046
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374825; ENSP00000363958; ENSG00000204256 [P25440-1]
ENST00000374831; ENSP00000363964; ENSG00000204256 [P25440-1]
ENST00000383108; ENSP00000372588; ENSG00000234507 [P25440-1]
ENST00000395287; ENSP00000378702; ENSG00000204256 [P25440-2]
ENST00000399527; ENSP00000382443; ENSG00000215077 [P25440-2]
ENST00000399528; ENSP00000382444; ENSG00000215077 [P25440-1]
ENST00000399529; ENSP00000382445; ENSG00000215077 [P25440-1]
ENST00000414731; ENSP00000391246; ENSG00000234704
ENST00000436979; ENSP00000405634; ENSG00000235307 [P25440-3]
ENST00000438194; ENSP00000401791; ENSG00000234507 [P25440-1]
ENST00000442863; ENSP00000410994; ENSG00000234507 [P25440-2]
ENST00000448067; ENSP00000412885; ENSG00000235307 [P25440-2]
ENST00000449085; ENSP00000409145; ENSG00000204256 [P25440-3]
ENST00000449118; ENSP00000399009; ENSG00000234704
ENST00000549126; ENSP00000449380; ENSG00000235307 [P25440-1]
ENST00000552587; ENSP00000449609; ENSG00000235307 [P25440-1]
GeneIDi6046
KEGGihsa:6046
UCSCiuc003ocn.4 human [P25440-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6046
DisGeNETi6046

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BRD2
HGNCiHGNC:1103 BRD2
HPAiHPA042816
MIMi601540 gene
neXtProtiNX_P25440
OpenTargetsiENSG00000204256
PharmGKBiPA25414

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1474 Eukaryota
COG5076 LUCA
GeneTreeiENSGT00940000153385
HOGENOMiHOG000231200
InParanoidiP25440
KOiK08871
OMAiESKPMTY
OrthoDBi1094764at2759
PhylomeDBiP25440
TreeFamiTF317345

Enzyme and pathway databases

ReactomeiR-HSA-8951936 RUNX3 regulates p14-ARF
SIGNORiP25440

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BRD2 human
EvolutionaryTraceiP25440

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BRD2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6046

Protein Ontology

More...
PROi
PR:P25440

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204256 Expressed in 234 organ(s), highest expression level in testis
ExpressionAtlasiP25440 baseline and differential
GenevisibleiP25440 HS

Family and domain databases

Gene3Di1.20.1270.220, 1 hit
1.20.920.10, 2 hits
InterProiView protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR018359 Bromodomain_CS
IPR027353 NET_dom
IPR038336 NET_sf
PfamiView protein in Pfam
PF17035 BET, 1 hit
PF00439 Bromodomain, 2 hits
PRINTSiPR00503 BROMODOMAIN
SMARTiView protein in SMART
SM00297 BROMO, 2 hits
SUPFAMiSSF47370 SSF47370, 2 hits
PROSITEiView protein in PROSITE
PS00633 BROMODOMAIN_1, 2 hits
PS50014 BROMODOMAIN_2, 2 hits
PS51525 NET, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBRD2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P25440
Secondary accession number(s): A2AAU0
, B0S7P0, B1AZT1, O00699, O00700, Q15310, Q5STC9, Q63HQ9, Q658Y7, Q6P3U2, Q969U4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 11, 2001
Last modified: June 5, 2019
This is version 193 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again