Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 185 (29 Sep 2021)
Sequence version 4 (14 May 2014)
Previous versions | rss
Add a publicationFeedback
Protein

Gamma-aminobutyric acid receptor subunit beta

Gene

Rdl

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Gamma-aminobutyric acid (GABA) receptor voltage channel subunit (PubMed:8016117, PubMed:8389005, PubMed:7527461, PubMed:8882620, PubMed:12805302, PubMed:24823815).

GABA, an inhibitory neurotransmitter, mediates neuronal inhibition by binding to the GABA receptor and opening an integral chloride channel (PubMed:8389005, PubMed:7527461, PubMed:12805302).

Together with glutamate receptor GluClalpha, plays an important role in the visual response by regulating the activity of ON/OFF-selective neurons (PubMed:31535971, PubMed:32075756).

Plays a role in promoting sleep and sleep latency by regulating the activity of peptidergic PDF neurons (PubMed:18223647, PubMed:19038223, PubMed:19230663).

In large ventral lateral clock neurons, clustering is mediated by Nlg4 and protein levels undergo daily degradation in response to the circadian clock (PubMed:24068821, PubMed:29174887).

In neurons in the mushroom bodies, has a role in odor memory acquisition where it inhibits appetitive and aversive olfactory learning, probably upstream of adenylyl cyclase rut and GTPase activating protein Nf1 (PubMed:18093529, PubMed:19193904).

In male-specific GABAergic neurons, plays a role in inhibiting male aggressive behavior during courtship (PubMed:24241395).

16 Publications

Gamma-aminobutyric acid (GABA) receptor voltage channel subunit.

1 Publication

Miscellaneous

Resistance is thought to be due to insensitivity of the cyclodiene/picrotoxinin binding site on the GABA(A) receptor-chloride ionophore complex.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by agonist muscimol (PubMed:8016117, PubMed:12805302, PubMed:8389005, PubMed:24823815). Insensitive to zinc, glycine, glutamate, and baclofen, loreclezole, to antagonist bicuculline, glycine-receptor antagonist strychnine, and nonselective GABA and glycine antagonist RU 5135 (PubMed:8016117, PubMed:8389005, PubMed:8882620, PubMed:12805302). Insensitive to flunitrazepam, pentobarbitone or pregnane steroids such as 5alpha-pregnan-3alpha-ol-20-one (PubMed:8016117, PubMed:8882620, PubMed:12805302). Inhibited by insecticides picrotoxin (PTX), cyclodiene dieldrin, TBPS and lindane (PubMed:8016117, PubMed:8389005, PubMed:7527461). Inhibited by ivermectin, fipronil and pyrafluprole (PubMed:24823815).6 Publications
Inhibited by insecticides picrotoxin (PTX).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChloride channel, Ion channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport
LigandChloride

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-977443, GABA receptor activation

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.9.5.11, the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Gamma-aminobutyric acid receptor subunit beta
Alternative name(s):
GABA(A) receptor subunit beta
Protein cyclodiene resistance
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rdl
ORF Names:CG10537
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0004244, Rdl

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
VectorBase:FBgn0004244

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini45 – 268ExtracellularSequence analysisAdd BLAST224
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei269 – 291HelicalSequence analysisAdd BLAST23
Transmembranei297 – 316HelicalSequence analysisAdd BLAST20
Transmembranei333 – 356HelicalSequence analysisAdd BLAST24
Topological domaini357 – 568CytoplasmicSequence analysisAdd BLAST212
Transmembranei569 – 590HelicalSequence analysisAdd BLAST22

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

In lobula columnar neurons 11 (LC11) results in a reduction of visual responses to the motion of small objects (PubMed:32075756). RNAi-mediated knockdown in neurons leads to dis-inhibition of male aggressive behavior (PubMed:24241395). RNAi-mediated knockdown in neurons in the alpha/beta mushroom bodies enhances learning (PubMed:18093529). RNAi-mediated knockdown in mushroom bodies enhances appetitive olfactory learning (PubMed:19193904). RNAi-mediated knockdown in PDF-expressing neurons results in decreased sleep but does not alter waking activity, circadian period, or rhythmicity under dark-dark conditions (PubMed:19230663). Simultaneous knockout of adenylate cyclase rut does not enhance the phenotype (PubMed:19193904). Simultaneous knockout of E3 ligase Fbxl4 results in significantly increased duration of daytime sleep and nighttime sleep as well as shortened sleep onset latency (PubMed:29174887).6 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi301A → S: Reduces in-current for inward flow of chloride ions, results in slower and incomplete desensitization which ultimately increases single channel open durations. Resistant to picrotoxinin (PTX) and cyclodiene dieldrin insecticides. Retains partial sensitivity to TBPS and lindane. Decreases sleep latency, increases total sleep time and shows resistance to carbamazepine sleep-induced effects on sleep both by itself or when associated with I-360. Restores defective sleep in Nlg4 and Lztr1 mutants. Retains resistance to picrotoxinin; when associated with V-283. 6 Publications1
Mutagenesisi360M → I: Decreases sleep latency; when associated with S-301. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 44Sequence analysisAdd BLAST44
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000045245 – 606Gamma-aminobutyric acid receptor subunit betaAdd BLAST562

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi185 ↔ 199By similarity
Glycosylationi253N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P25123

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in different parts of the brain: the mushroom bodies (alpha, alpha', beta, beta', gamma lobes and peduncles), the neurons projecting to the columnar-type neuron LC9 optic glomerulus, in interneurons connecting the paired olfactory lobes, antennal lobes, PDF-expressing small and large ventral lateral neurons (LNvs) of the circadian clock and lobula columnar neuron 11 (LC11) (at protein level) (PubMed:18093529, PubMed:19038223, PubMed:32339168, PubMed:19230663, PubMed:24068821, PubMed:29174887, PubMed:32075756). Expressed in all major ON pathway medulla neurons (Mi1, Tm3, Mi4, and Mi9) and in OFF pathway neurons (Tm1, Tm2, Tm4, and Tm9) (PubMed:31535971).8 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

In large ventral lateral neurons (lLNvs), undergoes daily rhythmic degradation which is inversely correlated with the activity of lLNvs, which is involved in the circadian clock (PubMed:29174887). Degradation levels are increased in the early hours of the morning and mediated by the E3 ubiquitin ligase Fbxl4 (PubMed:29174887).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0004244, Expressed in second segment of antenna (Drosophila) and 21 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P25123, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P25123, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms oligomers (PubMed:8882620).

Interacts with Nlg4; the interaction mediates Rdl clustering (PubMed:24068821).

Interacts with Fbxl4; the interaction mediates Rdl degradation (PubMed:29174887).

3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
64454, 7 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0305970

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P25123

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni376 – 451DisorderedSequence analysisAdd BLAST76
Regioni482 – 542DisorderedSequence analysisAdd BLAST61

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi376 – 393Polar residuesSequence analysisAdd BLAST18

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3643, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000169322

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P25123

Identification of Orthologs from Complete Genome Data

More...
OMAi
IRYKWNA

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.70.170.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006028, GABAA/Glycine_rcpt
IPR002289, GABAAb_rcpt
IPR006202, Neur_chan_lig-bd
IPR036734, Neur_chan_lig-bd_sf
IPR006201, Neur_channel
IPR036719, Neuro-gated_channel_TM_sf
IPR006029, Neurotrans-gated_channel_TM
IPR018000, Neurotransmitter_ion_chnl_CS

The PANTHER Classification System

More...
PANTHERi
PTHR18945, PTHR18945, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02931, Neur_chan_LBD, 1 hit
PF02932, Neur_chan_memb, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01160, GABAARBETA
PR00253, GABAARECEPTR
PR00252, NRIONCHANNEL

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF63712, SSF63712, 1 hit
SSF90112, SSF90112, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00860, LIC, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00236, NEUROTR_ION_CHANNEL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: P25123-2) [UniParc]FASTAAdd to basket
Also known as: F

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDSKMDKLA RMAPLPRTPL LTIWLAINMA LIAQETGHKR IHTVQAATGG
60 70 80 90 100
GSMLGDVNIS AILDSFSVSY DKRVRPNYGG PPVEVGVTMY VLSISSLSEV
110 120 130 140 150
KMDFTLDFYF RQFWTDPRLA YRKRPGVETL SVGSEFIKNI WVPDTFFVNE
160 170 180 190 200
KQSYFHIATT SNEFIRVHHS GSITRSIRLT ITASCPMNLQ YFPMDRQLCH
210 220 230 240 250
IEIESFGYTM RDIRYKWNEG PNSVGVSSEV SLPQFKVLGH RQRAMEISLT
260 270 280 290 300
TGNYSRLACE IQFVRSMGYY LIQIYIPSGL IVIISWVSFW LNRNATPARV
310 320 330 340 350
ALGVTTVLTM TTLMSSTNAA LPKISYVKSI DVYLGTCFVM VFASLLEYAT
360 370 380 390 400
VGYMAKRIQM RKQRFMAIQK IAEQKKQQLD GANQQQANPN PNANVGGPGG
410 420 430 440 450
VGVGPGGPGG PGGGVNVGVG MGMGPEHGHG HGHHAHSHGH PHAPKQTVSN
460 470 480 490 500
RPIGFSNIQQ NVGTRGCSIV GPLFQEVRFK VHDPKAHSKG GTLENTVNGG
510 520 530 540 550
RGGPQSHGPG PGQGGGPPGG GGGGGGGGGP PEGGGDPEAA VPAHLLHPGK
560 570 580 590 600
VKKDINKLLG ITPSDIDKYS RIVFPVCFVC FNLMYWIIYL HVSDVVADDL

VLLGEE
Length:606
Mass (Da):65,656
Last modified:May 14, 2014 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i25BDDCB03DAD54F8
GO
Isoform C (identifier: P25123-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-101: LSEVK → VSEVL
     216-248: KWNEGPNSVGVSSEVSLPQFKVLGHRQRAMEIS → FWRDGLSSVGMSSEVELPQFRVLGHRQRATEIN

Show »
Length:606
Mass (Da):65,762
Checksum:i9D4905CD066CBA03
GO
Isoform D1 Publication (identifier: P25123-3) [UniParc]FASTAAdd to basket
Also known as: B1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     216-248: KWNEGPNSVGVSSEVSLPQFKVLGHRQRAMEIS → FWRDGLSSVGMSSEVELPQFRVLGHRQRATEIN
     448-476: Missing.
     552-552: K → KKV

Show »
Length:579
Mass (Da):62,918
Checksum:i90D727510C013A16
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9PBZ1M9PBZ1_DROME
Resistant to dieldrin, isoform G
Rdl CT29555, Dmel\CG10537, DmRDL, DmRdl, GABA
608Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PEV8M9PEV8_DROME
Resistant to dieldrin, isoform E
Rdl CT29555, Dmel\CG10537, DmRDL, DmRdl, GABA
606Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PHV2M9PHV2_DROME
Resistant to dieldrin, isoform F
Rdl CT29555, Dmel\CG10537, DmRDL, DmRdl, GABA
606Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA28557 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAA28558 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAK92842 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti38H → N in AAA19249 (PubMed:8016117).Curated1
Sequence conflicti68V → I in AAA19249 (PubMed:8016117).Curated1
Sequence conflicti428G → R in AAA19249 (PubMed:8016117).Curated1

<p>This subsection of the 'Sequence' section provides information relevant to all types of RNA editing events (conversion, insertion, deletion of nucleotides) that lead to one or more amino acid changes compared to the translation of the non-edited RNA version.<p><a href='/help/rna_editing' target='_top'>More...</a></p>RNA editingi

Edited at positions 122, 283, 294 and 360.2 Publications
Partially edited.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti122R → G in RNA edited version. 2 Publications1
Natural varianti283I → V in RNA edited version; does not alter GABA receptor activity; retains inhibition by picrotoxin; shows resistance to picrotoxinin; when associated with S-301. 5 Publications1
Natural varianti294N → D in RNA edited version. 1 Publication1
Natural varianti360M → V in RNA edited version. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05445597 – 101LSEVK → VSEVL in isoform C. 1 Publication5
Alternative sequenceiVSP_054456216 – 248KWNEG…AMEIS → FWRDGLSSVGMSSEVELPQF RVLGHRQRATEIN in isoform C and isoform D. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_054457448 – 476Missing in isoform D. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_054458552K → KKV in isoform D. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M69057 mRNA Translation: AAA28556.1
M69057 mRNA Translation: AAA28557.1 Different initiation.
M69057 mRNA Translation: AAA28558.1 Different initiation.
U02042 mRNA Translation: AAA19249.1
AE014296 Genomic DNA Translation: AAF50311.1
AE014296 Genomic DNA Translation: AAN11988.1
AE014296 Genomic DNA Translation: AAN11989.2
AY051418 mRNA Translation: AAK92842.1 Frameshift.
S61113 mRNA Translation: AAB26669.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A41145

NCBI Reference Sequences

More...
RefSeqi
NP_001261616.1, NM_001274687.1 [P25123-2]
NP_523991.2, NM_079267.4 [P25123-2]
NP_729461.1, NM_168321.3 [P25123-1]
NP_729462.2, NM_168322.3 [P25123-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0076534; FBpp0076261; FBgn0004244 [P25123-2]
FBtr0076536; FBpp0076263; FBgn0004244 [P25123-1]
FBtr0309054; FBpp0301075; FBgn0004244 [P25123-3]
FBtr0333835; FBpp0305969; FBgn0004244 [P25123-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
39054

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG10537

Keywords - Coding sequence diversityi

Alternative splicing, RNA editing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M69057 mRNA Translation: AAA28556.1
M69057 mRNA Translation: AAA28557.1 Different initiation.
M69057 mRNA Translation: AAA28558.1 Different initiation.
U02042 mRNA Translation: AAA19249.1
AE014296 Genomic DNA Translation: AAF50311.1
AE014296 Genomic DNA Translation: AAN11988.1
AE014296 Genomic DNA Translation: AAN11989.2
AY051418 mRNA Translation: AAK92842.1 Frameshift.
S61113 mRNA Translation: AAB26669.1
PIRiA41145
RefSeqiNP_001261616.1, NM_001274687.1 [P25123-2]
NP_523991.2, NM_079267.4 [P25123-2]
NP_729461.1, NM_168321.3 [P25123-1]
NP_729462.2, NM_168322.3 [P25123-3]

3D structure databases

SMRiP25123
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi64454, 7 interactors
STRINGi7227.FBpp0305970

Protein family/group databases

TCDBi1.A.9.5.11, the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family

Proteomic databases

PaxDbiP25123

Genome annotation databases

EnsemblMetazoaiFBtr0076534; FBpp0076261; FBgn0004244 [P25123-2]
FBtr0076536; FBpp0076263; FBgn0004244 [P25123-1]
FBtr0309054; FBpp0301075; FBgn0004244 [P25123-3]
FBtr0333835; FBpp0305969; FBgn0004244 [P25123-2]
GeneIDi39054
KEGGidme:Dmel_CG10537

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
39054
FlyBaseiFBgn0004244, Rdl
VEuPathDBiVectorBase:FBgn0004244

Phylogenomic databases

eggNOGiKOG3643, Eukaryota
GeneTreeiENSGT00940000169322
InParanoidiP25123
OMAiIRYKWNA

Enzyme and pathway databases

ReactomeiR-DME-977443, GABA receptor activation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
39054, 0 hits in 3 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
39054

Protein Ontology

More...
PROi
PR:P25123

Gene expression databases

BgeeiFBgn0004244, Expressed in second segment of antenna (Drosophila) and 21 other tissues
ExpressionAtlasiP25123, baseline and differential
GenevisibleiP25123, DM

Family and domain databases

Gene3Di2.70.170.10, 1 hit
InterProiView protein in InterPro
IPR006028, GABAA/Glycine_rcpt
IPR002289, GABAAb_rcpt
IPR006202, Neur_chan_lig-bd
IPR036734, Neur_chan_lig-bd_sf
IPR006201, Neur_channel
IPR036719, Neuro-gated_channel_TM_sf
IPR006029, Neurotrans-gated_channel_TM
IPR018000, Neurotransmitter_ion_chnl_CS
PANTHERiPTHR18945, PTHR18945, 1 hit
PfamiView protein in Pfam
PF02931, Neur_chan_LBD, 1 hit
PF02932, Neur_chan_memb, 1 hit
PRINTSiPR01160, GABAARBETA
PR00253, GABAARECEPTR
PR00252, NRIONCHANNEL
SUPFAMiSSF63712, SSF63712, 1 hit
SSF90112, SSF90112, 1 hit
TIGRFAMsiTIGR00860, LIC, 1 hit
PROSITEiView protein in PROSITE
PS00236, NEUROTR_ION_CHANNEL, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGBRB_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P25123
Secondary accession number(s): P92138
, Q24561, Q26302, Q7JPX8, Q8IQB5, Q8IQB6, Q961R4, Q9TX51, Q9VSV0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: May 14, 2014
Last modified: September 29, 2021
This is version 185 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again