Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

ACP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
A phosphate monoester + H2O = an alcohol + phosphate.

Activity regulationi

Inhibited by sulfhydryl reagents.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei13NucleophileBy similarity1
Active sitei19By similarity1
Active sitei130Proton donorBy similarity1

GO - Molecular functioni

  • acid phosphatase activity Source: ProtInc
  • non-membrane spanning protein tyrosine phosphatase activity Source: InterPro

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
SignaLinkiP24666
SIGNORiP24666

Names & Taxonomyi

Protein namesi
Recommended name:
Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
Short name:
LMW-PTP
Short name:
LMW-PTPase
Alternative name(s):
Adipocyte acid phosphatase
Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
Red cell acid phosphatase 1
Gene namesi
Name:ACP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000143727.15
HGNCiHGNC:122 ACP1
MIMi171500 gene
neXtProtiNX_P24666

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi13C → S: Inactive. 1 Publication1
Mutagenesisi132Y → F: Reduced phosphorylation and activity. 1 Publication1
Mutagenesisi133Y → F: Reduced phosphorylation. No effect on activity. 1 Publication1

Organism-specific databases

DisGeNETi52
OpenTargetsiENSG00000143727
PharmGKBiPA24446

Chemistry databases

ChEMBLiCHEMBL4903
DrugBankiDB04214 4-Nitrophenyl Phosphate
DB00173 Adenine

Polymorphism and mutation databases

BioMutaiACP1
DMDMi1709543

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00000465582 – 158Low molecular weight phosphotyrosine protein phosphataseAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanine1 Publication1
Modified residuei132Phosphotyrosine1 Publication1
Modified residuei133Phosphotyrosine1 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP24666
MaxQBiP24666
PaxDbiP24666
PeptideAtlasiP24666
PRIDEiP24666
ProteomicsDBi54220
54221 [P24666-2]
54222 [P24666-3]

2D gel databases

REPRODUCTION-2DPAGEiIPI00218847
IPI00219861

PTM databases

DEPODiP24666
iPTMnetiP24666
PhosphoSitePlusiP24666
SwissPalmiP24666

Expressioni

Tissue specificityi

T-lymphocytes express only isoform 2.1 Publication

Gene expression databases

BgeeiENSG00000143727 Expressed in 226 organ(s), highest expression level in adrenal tissue
CleanExiHS_ACP1
ExpressionAtlasiP24666 baseline and differential
GenevisibleiP24666 HS

Organism-specific databases

HPAiHPA016754

Interactioni

Subunit structurei

Isoform 1 interacts with the SH3 domain of SPTAN1. There is no interaction observed for isoforms 2 or 3. Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1.3 Publications

Protein-protein interaction databases

BioGridi106568, 43 interactors
IntActiP24666, 10 interactors
STRINGi9606.ENSP00000272065

Chemistry databases

BindingDBiP24666

Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP24666
SMRiP24666
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP24666

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3217 Eukaryota
COG0394 LUCA
GeneTreeiENSGT00500000044891
HOGENOMiHOG000074091
HOVERGENiHBG007540
InParanoidiP24666
KOiK14394
OMAiAGTGSWH
OrthoDBiEOG091G0P0O
PhylomeDBiP24666
TreeFamiTF353727

Family and domain databases

InterProiView protein in InterPro
IPR023485 Ptyr_pPase
IPR036196 Ptyr_pPase_sf
IPR002115 Tyr_Pase_low_mol_wt_mml
IPR017867 Tyr_phospatase_low_mol_wt
PfamiView protein in Pfam
PF01451 LMWPc, 1 hit
PRINTSiPR00719 LMWPTPASE
PR00720 MAMMALPTPASE
SMARTiView protein in SMART
SM00226 LMWPc, 1 hit
SUPFAMiSSF52788 SSF52788, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Note: The ratio of isoform 1 to isoform 2 is 2:1 in allele A, 4:1 in allele B and 1:4 in allele C.

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P24666-1) [UniParc]FASTAAdd to basket
Also known as: F, A, Alpha, LMPTP-A, HCPTP-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEQATKSVL FVCLGNICRS PIAEAVFRKL VTDQNISENW RVDSAATSGY
60 70 80 90 100
EIGNPPDYRG QSCMKRHGIP MSHVARQITK EDFATFDYIL CMDESNLRDL
110 120 130 140 150
NRKSNQVKTC KAKIELLGSY DPQKQLIIED PYYGNDSDFE TVYQQCVRCC

RAFLEKAH
Length:158
Mass (Da):18,042
Last modified:January 23, 2007 - v3
Checksum:i46617BD799313EED
GO
Isoform 2 (identifier: P24666-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: S, B, Beta, LMPTP-B, HCPTP-B

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHV → VIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK

Show »
Length:158
Mass (Da):17,977
Checksum:iA137F38F06F39161
GO
Isoform 3 (identifier: P24666-3) [UniParc]FASTAAdd to basket
Also known as: C, LMPTP-C

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: Missing.

Show »
Length:124
Mass (Da):14,342
Checksum:iD68ED15D431D2484
GO
Isoform 4 (identifier: P24666-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     78-112: ITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKA → VPSLDLKLCVLCFSGSLTAVLFLTGTWAGPQTQEL
     113-158: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,230
Checksum:i805DBFA90F43D732
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YTI2D3YTI2_HUMAN
Low molecular weight phosphotyrosin...
ACP1
85Annotation score:
G5E9R5G5E9R5_HUMAN
Acid phosphatase 1, soluble, isofor...
ACP1 hCG_1784797
80Annotation score:
F2Z2Q9F2Z2Q9_HUMAN
Low molecular weight phosphotyrosin...
ACP1
70Annotation score:
F2Z2R9F2Z2R9_HUMAN
Low molecular weight phosphotyrosin...
ACP1
46Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2 – 6AEQAT → PRRGR in AAB27086 (PubMed:1304913).Curated5
Sequence conflicti2A → P in BP363227 (PubMed:16344560).Curated1
Sequence conflicti13 – 20CLGNICRS → PARREAAR in AAB27085 (PubMed:1304913).Curated8
Sequence conflicti32T → W AA sequence (PubMed:1939112).Curated1
Sequence conflicti32T → W AA sequence (PubMed:1627603).Curated1

Polymorphismi

ACP1 is genetically polymorphic. Three common alleles are known in Caucasians: ACP1*A, ACP1*B and ACP1*C. They give rise to six different phenotypes. Each allele appears to encode two electrophoretically different isozymes, F and S, which are produced in allele-specific ratios (PubMed:1939112). The sequence shown is that of allele ACP1*B and allele ACP1*C.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0505267K → N. Corresponds to variant dbSNP:rs11691572Ensembl.1
Natural variantiVAR_006171106Q → R in allele ACP1*A. 1 PublicationCorresponds to variant dbSNP:rs79716074EnsemblClinVar.1
Natural variantiVAR_050527137S → F. Corresponds to variant dbSNP:rs35569198Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01008741 – 74RVDSA…PMSHV → VIDSGAVSDWNVGRSPDPRA VSCLRNHGIHTAHK in isoform 2. 5 PublicationsAdd BLAST34
Alternative sequenceiVSP_01008841 – 74Missing in isoform 3. CuratedAdd BLAST34
Alternative sequenceiVSP_05407478 – 112ITKED…KTCKA → VPSLDLKLCVLCFSGSLTAV LFLTGTWAGPQTQEL in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_054075113 – 158Missing in isoform 4. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83653 mRNA Translation: AAB59354.1
M83654 mRNA Translation: AAB59355.1
U25849, U25847, U25848 Genomic DNA Translation: AAC52067.1
S62884 mRNA Translation: AAB27085.1
S62885 mRNA Translation: AAB27086.1
M87545 mRNA No translation available.
BT007136 mRNA Translation: AAP35800.1
AK289934 mRNA Translation: BAF82623.1
AK291861 mRNA Translation: BAF84550.1
BP363227 mRNA No translation available.
AC079779 Genomic DNA Translation: AAY14958.1
CH471053 Genomic DNA Translation: EAX01112.1
CH471053 Genomic DNA Translation: EAX01116.1
BC007422 mRNA Translation: AAH07422.1
BC106011 mRNA Translation: AAI06012.1
L06508 Genomic DNA Translation: AAB59628.1
CCDSiCCDS1639.1 [P24666-1]
CCDS1640.1 [P24666-2]
CCDS46217.1 [P24666-4]
PIRiA38148
B38148
RefSeqiNP_004291.1, NM_004300.3 [P24666-1]
NP_009030.1, NM_007099.3 [P24666-2]
UniGeneiHs.558296

Genome annotation databases

EnsembliENST00000272065; ENSP00000272065; ENSG00000143727 [P24666-1]
ENST00000272067; ENSP00000272067; ENSG00000143727 [P24666-2]
ENST00000407983; ENSP00000385404; ENSG00000143727 [P24666-4]
GeneIDi52
KEGGihsa:52
UCSCiuc002qwd.3 human [P24666-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83653 mRNA Translation: AAB59354.1
M83654 mRNA Translation: AAB59355.1
U25849, U25847, U25848 Genomic DNA Translation: AAC52067.1
S62884 mRNA Translation: AAB27085.1
S62885 mRNA Translation: AAB27086.1
M87545 mRNA No translation available.
BT007136 mRNA Translation: AAP35800.1
AK289934 mRNA Translation: BAF82623.1
AK291861 mRNA Translation: BAF84550.1
BP363227 mRNA No translation available.
AC079779 Genomic DNA Translation: AAY14958.1
CH471053 Genomic DNA Translation: EAX01112.1
CH471053 Genomic DNA Translation: EAX01116.1
BC007422 mRNA Translation: AAH07422.1
BC106011 mRNA Translation: AAI06012.1
L06508 Genomic DNA Translation: AAB59628.1
CCDSiCCDS1639.1 [P24666-1]
CCDS1640.1 [P24666-2]
CCDS46217.1 [P24666-4]
PIRiA38148
B38148
RefSeqiNP_004291.1, NM_004300.3 [P24666-1]
NP_009030.1, NM_007099.3 [P24666-2]
UniGeneiHs.558296

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XWWX-ray1.63A2-158[»]
3N8IX-ray1.50A2-158[»]
4Z99X-ray2.30A1-158[»]
4Z9AX-ray2.10A1-158[»]
4Z9BX-ray2.41A1-158[»]
5JNRX-ray2.00A1-158[»]
5JNSX-ray1.80A1-158[»]
5JNTX-ray1.45A1-158[»]
5KQGX-ray1.50A1-158[»]
5KQLX-ray1.45A1-158[»]
5KQMX-ray1.91A1-158[»]
5KQPX-ray2.05A1-158[»]
5PNTX-ray2.20A2-158[»]
ProteinModelPortaliP24666
SMRiP24666
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106568, 43 interactors
IntActiP24666, 10 interactors
STRINGi9606.ENSP00000272065

Chemistry databases

BindingDBiP24666
ChEMBLiCHEMBL4903
DrugBankiDB04214 4-Nitrophenyl Phosphate
DB00173 Adenine

PTM databases

DEPODiP24666
iPTMnetiP24666
PhosphoSitePlusiP24666
SwissPalmiP24666

Polymorphism and mutation databases

BioMutaiACP1
DMDMi1709543

2D gel databases

REPRODUCTION-2DPAGEiIPI00218847
IPI00219861

Proteomic databases

EPDiP24666
MaxQBiP24666
PaxDbiP24666
PeptideAtlasiP24666
PRIDEiP24666
ProteomicsDBi54220
54221 [P24666-2]
54222 [P24666-3]

Protocols and materials databases

DNASUi52
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272065; ENSP00000272065; ENSG00000143727 [P24666-1]
ENST00000272067; ENSP00000272067; ENSG00000143727 [P24666-2]
ENST00000407983; ENSP00000385404; ENSG00000143727 [P24666-4]
GeneIDi52
KEGGihsa:52
UCSCiuc002qwd.3 human [P24666-1]

Organism-specific databases

CTDi52
DisGeNETi52
EuPathDBiHostDB:ENSG00000143727.15
GeneCardsiACP1
HGNCiHGNC:122 ACP1
HPAiHPA016754
MIMi171500 gene
neXtProtiNX_P24666
OpenTargetsiENSG00000143727
PharmGKBiPA24446
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3217 Eukaryota
COG0394 LUCA
GeneTreeiENSGT00500000044891
HOGENOMiHOG000074091
HOVERGENiHBG007540
InParanoidiP24666
KOiK14394
OMAiAGTGSWH
OrthoDBiEOG091G0P0O
PhylomeDBiP24666
TreeFamiTF353727

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
SignaLinkiP24666
SIGNORiP24666

Miscellaneous databases

EvolutionaryTraceiP24666
GeneWikiiACP1
GenomeRNAii52
PROiPR:P24666
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143727 Expressed in 226 organ(s), highest expression level in adrenal tissue
CleanExiHS_ACP1
ExpressionAtlasiP24666 baseline and differential
GenevisibleiP24666 HS

Family and domain databases

InterProiView protein in InterPro
IPR023485 Ptyr_pPase
IPR036196 Ptyr_pPase_sf
IPR002115 Tyr_Pase_low_mol_wt_mml
IPR017867 Tyr_phospatase_low_mol_wt
PfamiView protein in Pfam
PF01451 LMWPc, 1 hit
PRINTSiPR00719 LMWPTPASE
PR00720 MAMMALPTPASE
SMARTiView protein in SMART
SM00226 LMWPc, 1 hit
SUPFAMiSSF52788 SSF52788, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPPAC_HUMAN
AccessioniPrimary (citable) accession number: P24666
Secondary accession number(s): A8K1L9
, B5MCC7, P24667, Q16035, Q16036, Q16725, Q3KQX8, Q53RU0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 202 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again