Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

ACP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by sulfhydryl reagents.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei13NucleophileBy similarity1
Active sitei19By similarity1
Active sitei130Proton donorBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • acid phosphatase activity Source: ProtInc
  • non-membrane spanning protein tyrosine phosphatase activity Source: InterPro

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.48 2681

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P24666

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P24666

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
Short name:
LMW-PTP
Short name:
LMW-PTPase
Alternative name(s):
Adipocyte acid phosphatase
Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
Red cell acid phosphatase 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143727.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:122 ACP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
171500 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P24666

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi13C → S: Inactive. 1 Publication1
Mutagenesisi132Y → F: Reduced phosphorylation and activity. 1 Publication1
Mutagenesisi133Y → F: Reduced phosphorylation. No effect on activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
52

Open Targets

More...
OpenTargetsi
ENSG00000143727

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24446

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4903

Drug and drug target database

More...
DrugBanki
DB04214 4-Nitrophenyl Phosphate
DB00173 Adenine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ACP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1709543

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000465582 – 158Low molecular weight phosphotyrosine protein phosphataseAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanine1 Publication1
Modified residuei132Phosphotyrosine1 Publication1
Modified residuei133Phosphotyrosine1 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P24666

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P24666

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P24666

PeptideAtlas

More...
PeptideAtlasi
P24666

PRoteomics IDEntifications database

More...
PRIDEi
P24666

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54220
54221 [P24666-2]
54222 [P24666-3]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00218847
IPI00219861

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
P24666

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P24666

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P24666

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P24666

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

T-lymphocytes express only isoform 2.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143727 Expressed in 226 organ(s), highest expression level in adrenal tissue

CleanEx database of gene expression profiles

More...
CleanExi
HS_ACP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P24666 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P24666 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA016754

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 1 interacts with the SH3 domain of SPTAN1. There is no interaction observed for isoforms 2 or 3. Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1.3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106568, 43 interactors

Protein interaction database and analysis system

More...
IntActi
P24666, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000272065

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P24666

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P24666

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P24666

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P24666

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3217 Eukaryota
COG0394 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162690

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000074091

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG007540

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P24666

KEGG Orthology (KO)

More...
KOi
K14394

Identification of Orthologs from Complete Genome Data

More...
OMAi
AGTGSWH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0P0O

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P24666

TreeFam database of animal gene trees

More...
TreeFami
TF353727

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR023485 Ptyr_pPase
IPR036196 Ptyr_pPase_sf
IPR002115 Tyr_Pase_low_mol_wt_mml
IPR017867 Tyr_phospatase_low_mol_wt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01451 LMWPc, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00719 LMWPTPASE
PR00720 MAMMALPTPASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00226 LMWPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52788 SSF52788, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: The ratio of isoform 1 to isoform 2 is 2:1 in allele A, 4:1 in allele B and 1:4 in allele C.

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P24666-1) [UniParc]FASTAAdd to basket
Also known as: F, A, Alpha, LMPTP-A, HCPTP-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEQATKSVL FVCLGNICRS PIAEAVFRKL VTDQNISENW RVDSAATSGY
60 70 80 90 100
EIGNPPDYRG QSCMKRHGIP MSHVARQITK EDFATFDYIL CMDESNLRDL
110 120 130 140 150
NRKSNQVKTC KAKIELLGSY DPQKQLIIED PYYGNDSDFE TVYQQCVRCC

RAFLEKAH
Length:158
Mass (Da):18,042
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i46617BD799313EED
GO
Isoform 2 (identifier: P24666-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: S, B, Beta, LMPTP-B, HCPTP-B

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHV → VIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK

Show »
Length:158
Mass (Da):17,977
Checksum:iA137F38F06F39161
GO
Isoform 3 (identifier: P24666-3) [UniParc]FASTAAdd to basket
Also known as: C, LMPTP-C

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: Missing.

Show »
Length:124
Mass (Da):14,342
Checksum:iD68ED15D431D2484
GO
Isoform 4 (identifier: P24666-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     78-112: ITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKA → VPSLDLKLCVLCFSGSLTAVLFLTGTWAGPQTQEL
     113-158: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,230
Checksum:i805DBFA90F43D732
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E9R5G5E9R5_HUMAN
Acid phosphatase 1, soluble, isofor...
ACP1 hCG_1784797
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YTI2D3YTI2_HUMAN
Low molecular weight phosphotyrosin...
ACP1
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2Q9F2Z2Q9_HUMAN
Low molecular weight phosphotyrosin...
ACP1
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2R9F2Z2R9_HUMAN
Low molecular weight phosphotyrosin...
ACP1
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2 – 6AEQAT → PRRGR in AAB27086 (PubMed:1304913).Curated5
Sequence conflicti2A → P in BP363227 (PubMed:16344560).Curated1
Sequence conflicti13 – 20CLGNICRS → PARREAAR in AAB27085 (PubMed:1304913).Curated8
Sequence conflicti32T → W AA sequence (PubMed:1939112).Curated1
Sequence conflicti32T → W AA sequence (PubMed:1627603).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

ACP1 is genetically polymorphic. Three common alleles are known in Caucasians: ACP1*A, ACP1*B and ACP1*C. They give rise to six different phenotypes. Each allele appears to encode two electrophoretically different isozymes, F and S, which are produced in allele-specific ratios (PubMed:1939112). The sequence shown is that of allele ACP1*B and allele ACP1*C.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0505267K → N. Corresponds to variant dbSNP:rs11691572Ensembl.1
Natural variantiVAR_006171106Q → R in allele ACP1*A. 1 PublicationCorresponds to variant dbSNP:rs79716074EnsemblClinVar.1
Natural variantiVAR_050527137S → F. Corresponds to variant dbSNP:rs35569198Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01008741 – 74RVDSA…PMSHV → VIDSGAVSDWNVGRSPDPRA VSCLRNHGIHTAHK in isoform 2. 5 PublicationsAdd BLAST34
Alternative sequenceiVSP_01008841 – 74Missing in isoform 3. CuratedAdd BLAST34
Alternative sequenceiVSP_05407478 – 112ITKED…KTCKA → VPSLDLKLCVLCFSGSLTAV LFLTGTWAGPQTQEL in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_054075113 – 158Missing in isoform 4. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M83653 mRNA Translation: AAB59354.1
M83654 mRNA Translation: AAB59355.1
U25849, U25847, U25848 Genomic DNA Translation: AAC52067.1
S62884 mRNA Translation: AAB27085.1
S62885 mRNA Translation: AAB27086.1
M87545 mRNA No translation available.
BT007136 mRNA Translation: AAP35800.1
AK289934 mRNA Translation: BAF82623.1
AK291861 mRNA Translation: BAF84550.1
BP363227 mRNA No translation available.
AC079779 Genomic DNA Translation: AAY14958.1
CH471053 Genomic DNA Translation: EAX01112.1
CH471053 Genomic DNA Translation: EAX01116.1
BC007422 mRNA Translation: AAH07422.1
BC106011 mRNA Translation: AAI06012.1
L06508 Genomic DNA Translation: AAB59628.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1639.1 [P24666-1]
CCDS1640.1 [P24666-2]
CCDS46217.1 [P24666-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A38148
B38148

NCBI Reference Sequences

More...
RefSeqi
NP_004291.1, NM_004300.3 [P24666-1]
NP_009030.1, NM_007099.3 [P24666-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.558296

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000272065; ENSP00000272065; ENSG00000143727 [P24666-1]
ENST00000272067; ENSP00000272067; ENSG00000143727 [P24666-2]
ENST00000407983; ENSP00000385404; ENSG00000143727 [P24666-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
52

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:52

UCSC genome browser

More...
UCSCi
uc002qwd.3 human [P24666-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83653 mRNA Translation: AAB59354.1
M83654 mRNA Translation: AAB59355.1
U25849, U25847, U25848 Genomic DNA Translation: AAC52067.1
S62884 mRNA Translation: AAB27085.1
S62885 mRNA Translation: AAB27086.1
M87545 mRNA No translation available.
BT007136 mRNA Translation: AAP35800.1
AK289934 mRNA Translation: BAF82623.1
AK291861 mRNA Translation: BAF84550.1
BP363227 mRNA No translation available.
AC079779 Genomic DNA Translation: AAY14958.1
CH471053 Genomic DNA Translation: EAX01112.1
CH471053 Genomic DNA Translation: EAX01116.1
BC007422 mRNA Translation: AAH07422.1
BC106011 mRNA Translation: AAI06012.1
L06508 Genomic DNA Translation: AAB59628.1
CCDSiCCDS1639.1 [P24666-1]
CCDS1640.1 [P24666-2]
CCDS46217.1 [P24666-4]
PIRiA38148
B38148
RefSeqiNP_004291.1, NM_004300.3 [P24666-1]
NP_009030.1, NM_007099.3 [P24666-2]
UniGeneiHs.558296

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XWWX-ray1.63A2-158[»]
3N8IX-ray1.50A2-158[»]
4Z99X-ray2.30A1-158[»]
4Z9AX-ray2.10A1-158[»]
4Z9BX-ray2.41A1-158[»]
5JNRX-ray2.00A1-158[»]
5JNSX-ray1.80A1-158[»]
5JNTX-ray1.45A1-158[»]
5KQGX-ray1.50A1-158[»]
5KQLX-ray1.45A1-158[»]
5KQMX-ray1.91A1-158[»]
5KQPX-ray2.05A1-158[»]
5PNTX-ray2.20A2-158[»]
ProteinModelPortaliP24666
SMRiP24666
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106568, 43 interactors
IntActiP24666, 10 interactors
STRINGi9606.ENSP00000272065

Chemistry databases

BindingDBiP24666
ChEMBLiCHEMBL4903
DrugBankiDB04214 4-Nitrophenyl Phosphate
DB00173 Adenine

PTM databases

DEPODiP24666
iPTMnetiP24666
PhosphoSitePlusiP24666
SwissPalmiP24666

Polymorphism and mutation databases

BioMutaiACP1
DMDMi1709543

2D gel databases

REPRODUCTION-2DPAGEiIPI00218847
IPI00219861

Proteomic databases

EPDiP24666
MaxQBiP24666
PaxDbiP24666
PeptideAtlasiP24666
PRIDEiP24666
ProteomicsDBi54220
54221 [P24666-2]
54222 [P24666-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
52
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272065; ENSP00000272065; ENSG00000143727 [P24666-1]
ENST00000272067; ENSP00000272067; ENSG00000143727 [P24666-2]
ENST00000407983; ENSP00000385404; ENSG00000143727 [P24666-4]
GeneIDi52
KEGGihsa:52
UCSCiuc002qwd.3 human [P24666-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
52
DisGeNETi52
EuPathDBiHostDB:ENSG00000143727.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ACP1
HGNCiHGNC:122 ACP1
HPAiHPA016754
MIMi171500 gene
neXtProtiNX_P24666
OpenTargetsiENSG00000143727
PharmGKBiPA24446

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3217 Eukaryota
COG0394 LUCA
GeneTreeiENSGT00940000162690
HOGENOMiHOG000074091
HOVERGENiHBG007540
InParanoidiP24666
KOiK14394
OMAiAGTGSWH
OrthoDBiEOG091G0P0O
PhylomeDBiP24666
TreeFamiTF353727

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
SignaLinkiP24666
SIGNORiP24666

Miscellaneous databases

EvolutionaryTraceiP24666

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ACP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
52

Protein Ontology

More...
PROi
PR:P24666

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143727 Expressed in 226 organ(s), highest expression level in adrenal tissue
CleanExiHS_ACP1
ExpressionAtlasiP24666 baseline and differential
GenevisibleiP24666 HS

Family and domain databases

InterProiView protein in InterPro
IPR023485 Ptyr_pPase
IPR036196 Ptyr_pPase_sf
IPR002115 Tyr_Pase_low_mol_wt_mml
IPR017867 Tyr_phospatase_low_mol_wt
PfamiView protein in Pfam
PF01451 LMWPc, 1 hit
PRINTSiPR00719 LMWPTPASE
PR00720 MAMMALPTPASE
SMARTiView protein in SMART
SM00226 LMWPc, 1 hit
SUPFAMiSSF52788 SSF52788, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPPAC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P24666
Secondary accession number(s): A8K1L9
, B5MCC7, P24667, Q16035, Q16036, Q16725, Q3KQX8, Q53RU0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: January 23, 2007
Last modified: December 5, 2018
This is version 203 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again