Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P24557 (THAS_HUMAN)

Entry version 217 (10 Feb 2021)
Sequence version 3 (28 Jul 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Thromboxane-A synthase

Gene

TBXAS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the conversion of prostaglandin H2 (PGH2) to thromboxane A2 (TXA2), a potent inducer of blood vessel constriction and platelet aggregation (PubMed:8436233, PubMed:11297515, PubMed:9873013, PubMed:11097184, PubMed:24009185, PubMed:22735388). Cleaves also PGH2 to 12-hydroxy-heptadecatrienoicacid (12-HHT) and malondialdehyde, which is known to act as a mediator of DNA damage. 12-HHT and malondialdehyde are formed stoichiometrically in the same amounts as TXA2 (PubMed:11297515, PubMed:9873013, PubMed:22735388). Additionally, displays dehydratase activity, toward (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate (15(S)-HPETE) producing 15-KETE and 15-HETE (PubMed:17459323).7 Publications

Caution

It is uncertain whether Met-1 is the initiator. An alternative upstream Met is found in primates, but not in other mammals.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

heme1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=80 µM for 15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate (15-HPETE)1 Publication
  2. KM=32 µM for prostaglandin H21 Publication
  3. KM=20 µM for prostaglandin H21 Publication
  1. Vmax=12 µmol/min/mg enzyme for prostaglandin H2 as substrate1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: fatty acid metabolism

This protein is involved in the pathway fatty acid metabolism, which is part of Lipid metabolism.Curated
View all proteins of this organism that are known to be involved in the pathway fatty acid metabolism and in Lipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi479Iron (heme axial ligand)By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase, Lyase, Monooxygenase, Oxidoreductase
Biological processFatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS00728-MONOMER

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P24557

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-211979, Eicosanoids
R-HSA-2162123, Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
R-HSA-5579032, Defective TBXAS1 causes Ghosal hematodiaphyseal dysplasia (GHDD)

SIGNOR Signaling Network Open Resource

More...SIGNORi		P24557

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00199

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001099

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Thromboxane-A synthase (EC:5.3.99.56 Publications)
Short name:
TXA synthase
Short name:
TXS1 Publication
Alternative name(s):
Cytochrome P450 5A1
Hydroperoxy icosatetraenoate dehydrataseCurated (EC:4.2.1.1521 Publication)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TBXAS1
Synonyms:CYP5, CYP5A11 Publication, TXAS
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11609, TBXAS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		274180, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P24557

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000059377.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 10Cytoplasmic1 Publication10
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei11 – 31HelicalSequence analysisAdd BLAST21
Topological domaini32 – 75Lumenal1 PublicationAdd BLAST44
Transmembranei76 – 96HelicalSequence analysisAdd BLAST21
Topological domaini97 – 223Cytoplasmic1 PublicationAdd BLAST127
Transmembranei224 – 244HelicalSequence analysisAdd BLAST21
Topological domaini245 – 335Lumenal1 PublicationAdd BLAST91
Transmembranei336 – 356HelicalSequence analysisAdd BLAST21
Topological domaini357 – 533Cytoplasmic1 PublicationAdd BLAST177

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Ghosal hematodiaphyseal dysplasia (GHDD)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionRare autosomal recessive disorder characterized by increased bone density with predominant diaphyseal involvement and aregenerative corticosteroid-sensitive anemia. Aregenerative anemia is characterized by bone marrow failure, so that functional marrow cells are regenerated slowly or not at all.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04438682L → P in GHDD. 1 PublicationCorresponds to variant dbSNP:rs140005285Ensembl.1
Natural variantiVAR_044388412R → Q in GHDD. 1 PublicationCorresponds to variant dbSNP:rs199422117EnsemblClinVar.1
Natural variantiVAR_044389481G → W in GHDD. 1 PublicationCorresponds to variant dbSNP:rs199422116Ensembl.1
Natural variantiVAR_044390487L → P in GHDD. 1 PublicationCorresponds to variant dbSNP:rs199422114Ensembl.1
Thromboxane synthetase deficiency has been detected in some patients with a bleeding disorder due to platelet dysfunction.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi109N → I: Loss of thromboxane-A synthase activity. Decreased heme-binding. 1 Publication1
Mutagenesisi132W → F: Loss of thromboxane-A synthase activity. Decreased heme-binding. 1 Publication1
Mutagenesisi134E → D: Does not affect thromboxane-A synthase activity. Does not affect heme-binding. 1 Publication1
Mutagenesisi136R → A or K: Loss of thromboxane-A synthase activity. Decreased heme-binding. 1 Publication1
Mutagenesisi409R → G: Does not affect thromboxane-A synthase activity. Does not affect heme-binding. 1 Publication1
Mutagenesisi412R → K: Loss of thromboxane-A synthase activity. Decreased heme-binding. 1 Publication1
Mutagenesisi414A → V: Does not affect thromboxane-A synthase activity. Does not affect heme-binding. 1 Publication1
Mutagenesisi477R → A: Loss of thromboxane-A synthase activity. Decreased heme-binding. 1 Publication1
Mutagenesisi479C → S, H or Y: Loss of thromboxane-A synthase activity. Decreased heme-binding. 1 Publication1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		6916

MalaCards human disease database

More...MalaCardsi		TBXAS1
MIMi231095, phenotype

Open Targets

More...OpenTargetsi		ENSG00000059377

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		1802, Ghosal hematodiaphyseal dysplasia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA349

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P24557, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1835

Drug and drug target database

More...DrugBanki		DB03052, Dazoxiben
DB05505, NM-702
DB01207, Ridogrel
DB00795, Sulfasalazine

DrugCentral

More...DrugCentrali		P24557

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1353

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TBXAS1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000522561 – 533Thromboxane-A synthaseAdd BLAST533

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P24557

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P24557

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P24557

MaxQB - The MaxQuant DataBase

More...MaxQBi		P24557

PeptideAtlas

More...PeptideAtlasi		P24557

PRoteomics IDEntifications database

More...PRIDEi		P24557

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		17017
17264
17954
54216 [P24557-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P24557

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P24557

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000059377, Expressed in monocyte and 144 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P24557, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P24557, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000059377, Tissue enhanced (blood, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112778, 4 interactors

Protein interaction database and analysis system

More...IntActi		P24557, 4 interactors

Molecular INTeraction database

More...MINTi		P24557

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000389414

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P24557

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P24557, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P24557

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0158, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157903

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001570_5_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P24557

Identification of Orthologs from Complete Genome Data

More...OMAi		FDIVRQV

Database of Orthologous Groups

More...OrthoDBi		750182at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P24557

TreeFam database of animal gene trees

More...TreeFami		TF105087

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.630.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR002401, Cyt_P450_E_grp-I
IPR036396, Cyt_P450_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00067, p450, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00463, EP450I
PR00385, P450

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48264, SSF48264, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P24557-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEALGFLKLE VNGPMVTVAL SVALLALLKW YSTSAFSRLE KLGLRHPKPS 
        60         70         80         90        100
PFIGNLTFFR QGFWESQMEL RKLYGPLCGY YLGRRMFIVI SEPDMIKQVL 
       110        120        130        140        150
VENFSNFTNR MASGLEFKSV ADSVLFLRDK RWEEVRGALM SAFSPEKLNE 
       160        170        180        190        200
MVPLISQACD LLLAHLKRYA ESGDAFDIQR CYCNYTTDVV ASVAFGTPVD 
       210        220        230        240        250
SWQAPEDPFV KHCKRFFEFC IPRPILVLLL SFPSIMVPLA RILPNKNRDE 
       260        270        280        290        300
LNGFFNKLIR NVIALRDQQA AEERRRDFLQ MVLDARHSAS PMGVQDFDIV 
       310        320        330        340        350
RDVFSSTGCK PNPSRQHQPS PMARPLTVDE IVGQAFIFLI AGYEIITNTL 
       360        370        380        390        400
SFATYLLATN PDCQEKLLRE VDVFKEKHMA PEFCSLEEGL PYLDMVIAET 
       410        420        430        440        450
LRMYPPAFRF TREAAQDCEV LGQRIPAGAV LEMAVGALHH DPEHWPSPET 
       460        470        480        490        500
FNPERFTAEA RQQHRPFTYL PFGAGPRSCL GVRLGLLEVK LTLLHVLHKF 
       510        520        530 
RFQACPETQV PLQLESKSAL GPKNGVYIKI VSR
Length:533
Mass (Da):60,518
Last modified:July 28, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE95E7B7EA77E6DDC
GO
Isoform 2 (identifier: P24557-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Show »
Length:466
Mass (Da):52,995
Checksum:iE214331AAC1B7797
GO
Isoform 3 (identifier: P24557-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-150: E → ELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFC

Show »
Length:579
Mass (Da):65,632
Checksum:iB3FF6087E8892CCF
GO
Isoform 4 (identifier: P24557-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     456-459: FTAE → YRCS
     460-533: Missing.

Show »
Length:459
Mass (Da):52,287
Checksum:i7AE5A27B6467D359
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DH47A0A0C4DH47_HUMAN
Thromboxane-A synthase
TBXAS1
580Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q53F23Q53F23_HUMAN
HCG14925, isoform CRA_a
TBXAS1 hCG_14925
534Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC80F8WC80_HUMAN
Thromboxane-A synthase
TBXAS1
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WD37F8WD37_HUMAN
Thromboxane-A synthase
TBXAS1
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSK3A0A0A0MSK3_HUMAN
HCG14925, isoform CRA_b
TBXAS1 hCG_14925
460Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JS68C9JS68_HUMAN
Thromboxane-A synthase
TBXAS1
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A498U6I9A0A498U6I9_HUMAN
Thromboxane-A synthase
TBXAS1
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA60617 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAA60618 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAC01761 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAC01761 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAF99269 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99270 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99271 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99272 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99273 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99274 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99275 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99276 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99277 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99278 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAF99279 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAH41157 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAG58828 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence EAW83934 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti102E → Q in AAA36742 (PubMed:2043115).Curated1
Sequence conflicti148L → V in AAC01761 (Ref. 4) Curated1
Sequence conflicti194A → P in AAA60617 (PubMed:1730669).Curated1
Sequence conflicti194A → P in AAA60618 (PubMed:1730669).Curated1
Sequence conflicti194A → P in AAC01761 (Ref. 4) Curated1
Sequence conflicti194A → P in AAF99269 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99270 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99271 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99272 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99273 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99274 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99275 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99276 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99277 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99278 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99279 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAA36742 (PubMed:2043115).Curated1
Sequence conflicti385S → G no nucleotide entry (PubMed:1714723).Curated1
Sequence conflicti483R → H in BAA07011 (PubMed:7925341).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01415760R → H in allele CYP5A1*2. 2 PublicationsCorresponds to variant dbSNP:rs6138Ensembl.1
Natural variantiVAR_05846570L → P. Corresponds to variant dbSNP:rs13306050Ensembl.1
Natural variantiVAR_05846670L → V. Corresponds to variant dbSNP:rs4529EnsemblClinVar.1
Natural variantiVAR_04438682L → P in GHDD. 1 PublicationCorresponds to variant dbSNP:rs140005285Ensembl.1
Natural variantiVAR_03629485R → W in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1016604233Ensembl.1
Natural variantiVAR_018378124V → I1 PublicationCorresponds to variant dbSNP:rs8192833Ensembl.1
Natural variantiVAR_010919160D → E in allele CYP5A1*3. 2 PublicationsCorresponds to variant dbSNP:rs5768EnsemblClinVar.1
Natural variantiVAR_014158162L → I1 PublicationCorresponds to variant dbSNP:rs6137Ensembl.1
Natural variantiVAR_010920245N → S in allele CYP5A1*4. 1 PublicationCorresponds to variant dbSNP:rs55856189Ensembl.1
Natural variantiVAR_014647257K → E The KM value is about 1.5 higher for PEG2; in allele CYP5A1*5; KM value about 1.5 higher for PEG2; Vmax/KM approximately 50% of that of the wild-type. 1 PublicationCorresponds to variant dbSNP:rs5769EnsemblClinVar.1
Natural variantiVAR_014648260R → G. Corresponds to variant dbSNP:rs5770Ensembl.1
Natural variantiVAR_014649316Q → K. Corresponds to variant dbSNP:rs5771Ensembl.1
Natural variantiVAR_014159331I → T1 PublicationCorresponds to variant dbSNP:rs6140EnsemblClinVar.1
Natural variantiVAR_010921356L → V in allele CYP5A1*5; KM value about 1.5 higher for PEG2; Vmax/KM approximately 27% of that of the wild-type. 4 PublicationsCorresponds to variant dbSNP:rs4529EnsemblClinVar.1
Natural variantiVAR_044387357L → V. Corresponds to variant dbSNP:rs4529EnsemblClinVar.1
Natural variantiVAR_055565387E → K. Corresponds to variant dbSNP:rs3735354EnsemblClinVar.1
Natural variantiVAR_018379388E → K1 PublicationCorresponds to variant dbSNP:rs3735354EnsemblClinVar.1
Natural variantiVAR_016158389G → V. Corresponds to variant dbSNP:rs5760Ensembl.1
Natural variantiVAR_044388412R → Q in GHDD. 1 PublicationCorresponds to variant dbSNP:rs199422117EnsemblClinVar.1
Natural variantiVAR_010922416Q → E in allele CYP5A1*6; does not affect KM value for PEG2; does not affect Vmax/KM value. 4 PublicationsCorresponds to variant dbSNP:rs4528EnsemblClinVar.1
Natural variantiVAR_014160424R → C1 PublicationCorresponds to variant dbSNP:rs5762Ensembl.1
Natural variantiVAR_014161429A → T2 PublicationsCorresponds to variant dbSNP:rs4526EnsemblClinVar.1
Natural variantiVAR_010923449E → K in allele CYP5A1*7; does not affect KM value for PEG2; does not affect Vmax/KM value. 3 PublicationsCorresponds to variant dbSNP:rs8192868EnsemblClinVar.1
Natural variantiVAR_010924450T → N in allele CYP5A1*8; KM value about 1.5 higher for PEG2; Vmax/KM approximately 56 % of that of the wild-type. 2 PublicationsCorresponds to variant dbSNP:rs5763EnsemblClinVar.1
Natural variantiVAR_010925465R → Q in allele CYP5A1*9. 1 PublicationCorresponds to variant dbSNP:rs41311778Ensembl.1
Natural variantiVAR_044389481G → W in GHDD. 1 PublicationCorresponds to variant dbSNP:rs199422116Ensembl.1
Natural variantiVAR_044390487L → P in GHDD. 1 PublicationCorresponds to variant dbSNP:rs199422114Ensembl.1
Natural variantiVAR_018380501R → Q1 PublicationCorresponds to variant dbSNP:rs8192864Ensembl.1
Natural variantiVAR_055566511P → L. Corresponds to variant dbSNP:rs13306050Ensembl.1
Natural variantiVAR_044391512L → P. Corresponds to variant dbSNP:rs13306050Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0472171 – 67Missing in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_054121150E → ELGLLIMQERIKGHMGGQQA PQRIPPTRLSKPSGIYVNLH YATLPFC in isoform 3. 1 Publication1
Alternative sequenceiVSP_054122456 – 459FTAE → YRCS in isoform 4. 1 Publication4
Alternative sequenceiVSP_054123460 – 533Missing in isoform 4. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M80646 mRNA Translation: AAA60617.1 Different initiation.
M80647 mRNA Translation: AAA60618.1 Different initiation.
D34625 Genomic DNA Translation: BAA07011.1
L36085 L36084 Genomic DNA Translation: AAC01761.1 Different initiation.
AF233615 Genomic DNA Translation: AAF99269.1 Different initiation.
AF233616 Genomic DNA Translation: AAF99270.1 Different initiation.
AF233617 Genomic DNA Translation: AAF99271.1 Different initiation.
AF233618 Genomic DNA Translation: AAF99272.1 Different initiation.
AF233619 Genomic DNA Translation: AAF99273.1 Different initiation.
AF233620 Genomic DNA Translation: AAF99274.1 Different initiation.
AF233621 Genomic DNA Translation: AAF99275.1 Different initiation.
AF233622 Genomic DNA Translation: AAF99276.1 Different initiation.
AF233623 Genomic DNA Translation: AAF99277.1 Different initiation.
AF233624 Genomic DNA Translation: AAF99278.1 Different initiation.
AF233625 Genomic DNA Translation: AAF99279.1 Different initiation.
AK296069 mRNA Translation: BAG58828.1 Different initiation.
AC004914 Genomic DNA No translation available.
AC004961 Genomic DNA No translation available.
AC006021 Genomic DNA No translation available.
CH471070 Genomic DNA Translation: EAW83934.1 Different initiation.
BC014117 mRNA Translation: AAH14117.1
BC041157 mRNA Translation: AAH41157.1 Different initiation.
M74055 mRNA Translation: AAA36742.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55174.1 [P24557-3]
CCDS55175.1 [P24557-2]
CCDS5855.1 [P24557-1]
CCDS5856.1 [P24557-4]

Protein sequence database of the Protein Information Resource

More...PIRi		A41766
S48161

NCBI Reference Sequences

More...RefSeqi		NP_001052.2, NM_001061.4 [P24557-1]
NP_001124438.1, NM_001130966.2 [P24557-1]
NP_001159725.1, NM_001166253.1 [P24557-3]
NP_001159726.1, NM_001166254.1 [P24557-2]
NP_112246.2, NM_030984.3 [P24557-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000336425; ENSP00000338087; ENSG00000059377 [P24557-1]
ENST00000411653; ENSP00000411326; ENSG00000059377 [P24557-4]
ENST00000425687; ENSP00000388736; ENSG00000059377 [P24557-2]
ENST00000448866; ENSP00000402536; ENSG00000059377 [P24557-1]
ENST00000458722; ENSP00000411274; ENSG00000059377 [P24557-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6916

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6916

UCSC genome browser

More...UCSCi		uc010lne.4, human [P24557-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP5A1 alleles

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80646 mRNA Translation: AAA60617.1 Different initiation.
M80647 mRNA Translation: AAA60618.1 Different initiation.
D34625 Genomic DNA Translation: BAA07011.1
L36085 L36084 Genomic DNA Translation: AAC01761.1 Different initiation.
AF233615 Genomic DNA Translation: AAF99269.1 Different initiation.
AF233616 Genomic DNA Translation: AAF99270.1 Different initiation.
AF233617 Genomic DNA Translation: AAF99271.1 Different initiation.
AF233618 Genomic DNA Translation: AAF99272.1 Different initiation.
AF233619 Genomic DNA Translation: AAF99273.1 Different initiation.
AF233620 Genomic DNA Translation: AAF99274.1 Different initiation.
AF233621 Genomic DNA Translation: AAF99275.1 Different initiation.
AF233622 Genomic DNA Translation: AAF99276.1 Different initiation.
AF233623 Genomic DNA Translation: AAF99277.1 Different initiation.
AF233624 Genomic DNA Translation: AAF99278.1 Different initiation.
AF233625 Genomic DNA Translation: AAF99279.1 Different initiation.
AK296069 mRNA Translation: BAG58828.1 Different initiation.
AC004914 Genomic DNA No translation available.
AC004961 Genomic DNA No translation available.
AC006021 Genomic DNA No translation available.
CH471070 Genomic DNA Translation: EAW83934.1 Different initiation.
BC014117 mRNA Translation: AAH14117.1
BC041157 mRNA Translation: AAH41157.1 Different initiation.
M74055 mRNA Translation: AAA36742.1
CCDSiCCDS55174.1 [P24557-3]
CCDS55175.1 [P24557-2]
CCDS5855.1 [P24557-1]
CCDS5856.1 [P24557-4]
PIRiA41766
S48161
RefSeqiNP_001052.2, NM_001061.4 [P24557-1]
NP_001124438.1, NM_001130966.2 [P24557-1]
NP_001159725.1, NM_001166253.1 [P24557-3]
NP_001159726.1, NM_001166254.1 [P24557-2]
NP_112246.2, NM_030984.3 [P24557-4]

3D structure databases

SMRiP24557
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi112778, 4 interactors
IntActiP24557, 4 interactors
MINTiP24557
STRINGi9606.ENSP00000389414

Chemistry databases

BindingDBiP24557
ChEMBLiCHEMBL1835
DrugBankiDB03052, Dazoxiben
DB05505, NM-702
DB01207, Ridogrel
DB00795, Sulfasalazine
DrugCentraliP24557
GuidetoPHARMACOLOGYi1353
SwissLipidsiSLP:000001099

PTM databases

iPTMnetiP24557
PhosphoSitePlusiP24557

Genetic variation databases

BioMutaiTBXAS1

Proteomic databases

EPDiP24557
jPOSTiP24557
MassIVEiP24557
MaxQBiP24557
PeptideAtlasiP24557
PRIDEiP24557
ProteomicsDBi17017
17264
17954
54216 [P24557-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		18246, 431 antibodies

The DNASU plasmid repository

More...DNASUi		6916

Genome annotation databases

EnsembliENST00000336425; ENSP00000338087; ENSG00000059377 [P24557-1]
ENST00000411653; ENSP00000411326; ENSG00000059377 [P24557-4]
ENST00000425687; ENSP00000388736; ENSG00000059377 [P24557-2]
ENST00000448866; ENSP00000402536; ENSG00000059377 [P24557-1]
ENST00000458722; ENSP00000411274; ENSG00000059377 [P24557-3]
GeneIDi6916
KEGGihsa:6916
UCSCiuc010lne.4, human [P24557-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6916
DisGeNETi6916

GeneCards: human genes, protein and diseases

More...GeneCardsi		TBXAS1
HGNCiHGNC:11609, TBXAS1
HPAiENSG00000059377, Tissue enhanced (blood, lymphoid tissue)
MalaCardsiTBXAS1
MIMi231095, phenotype
274180, gene
neXtProtiNX_P24557
OpenTargetsiENSG00000059377
Orphaneti1802, Ghosal hematodiaphyseal dysplasia
PharmGKBiPA349
VEuPathDBiHostDB:ENSG00000059377.15

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0158, Eukaryota
GeneTreeiENSGT00940000157903
HOGENOMiCLU_001570_5_2_1
InParanoidiP24557
OMAiFDIVRQV
OrthoDBi750182at2759
PhylomeDBiP24557
TreeFamiTF105087

Enzyme and pathway databases

UniPathwayiUPA00199
BioCyciMetaCyc:HS00728-MONOMER
PathwayCommonsiP24557
ReactomeiR-HSA-211979, Eicosanoids
R-HSA-2162123, Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
R-HSA-5579032, Defective TBXAS1 causes Ghosal hematodiaphyseal dysplasia (GHDD)
SIGNORiP24557

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6916, 7 hits in 877 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TBXAS1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Thromboxane-A_synthase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6916
PharosiP24557, Tchem

Protein Ontology

More...PROi		PR:P24557
RNActiP24557, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000059377, Expressed in monocyte and 144 other tissues
ExpressionAtlasiP24557, baseline and differential
GenevisibleiP24557, HS

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR002401, Cyt_P450_E_grp-I
IPR036396, Cyt_P450_sf
PfamiView protein in Pfam
PF00067, p450, 2 hits
PRINTSiPR00463, EP450I
PR00385, P450
SUPFAMiSSF48264, SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTHAS_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P24557
Secondary accession number(s): B4DJG6
, E7EMU9, E7EP08, E7ESB5, O14987, Q16843, Q16844, Q8IUN1, Q96CN2, Q9GZW4, Q9HD77, Q9HD78, Q9HD79, Q9HD80, Q9HD81, Q9HD82, Q9HD83, Q9HD84
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: July 28, 2009
Last modified: February 10, 2021
This is version 217 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human entries with genetic variants
    List of human entries with genetic variants
  2. Human variants curated from literature reports
    Index of human variants curated from literature reports
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again