Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Growth arrest and DNA damage-inducible protein GADD45 alpha

Gene

GADD45A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, DNA damage, Growth arrest

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P24522

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Growth arrest and DNA damage-inducible protein GADD45 alpha
Alternative name(s):
DNA damage-inducible transcript 1 protein
Short name:
DDIT-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GADD45A
Synonyms:DDIT1, GADD45
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000116717.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4095 GADD45A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
126335 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P24522

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi77L → E: Abolishes dimerization. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
1647

Open Targets

More...
OpenTargetsi
ENSG00000116717

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28510

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GADD45A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
120751

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001483311 – 165Growth arrest and DNA damage-inducible protein GADD45 alphaAdd BLAST165

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P24522

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P24522

PeptideAtlas

More...
PeptideAtlasi
P24522

PRoteomics IDEntifications database

More...
PRIDEi
P24522

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54209
54210 [P24522-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P24522

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P24522

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By UV irradiation, X-rays, growth arrest and alkylating agents. The induction is mediated by some kinase(s) other than PKC.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116717 Expressed in 231 organ(s), highest expression level in quadriceps femoris

CleanEx database of gene expression profiles

More...
CleanExi
HS_GADD45A

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P24522 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P24522 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA053420

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAPK14 (By similarity). Predominantly monomeric but also forms dimers and other oligomers as concentration increases. Interacts with GADD45GIP1. Interacts weakly with PCNA. Interacts with AURKA, likely to compete with dimerization.By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108014, 89 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P24522

Database of interacting proteins

More...
DIPi
DIP-24217N

Protein interaction database and analysis system

More...
IntActi
P24522, 62 interactors

Molecular INTeraction database

More...
MINTi
P24522

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360025

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1165
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KG4NMR-A1-165[»]

Database of protein disorder

More...
DisProti
DP00704

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P24522

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P24522

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P24522

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 16Intrinsically disorderedAdd BLAST16
Regioni105 – 118Intrinsically disorderedAdd BLAST14

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GADD45 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFHI Eukaryota
ENOG4111M8M LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154140

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013221

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P24522

KEGG Orthology (KO)

More...
KOi
K04402

Identification of Orthologs from Complete Genome Data

More...
OMAi
QWVPIIN

Database of Orthologous Groups

More...
OrthoDBi
1517160at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P24522

TreeFam database of animal gene trees

More...
TreeFami
TF300196

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1330.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024824 GADD45
IPR029064 L30e-like
IPR004038 Ribosomal_L7Ae/L30e/S12e/Gad45

The PANTHER Classification System

More...
PANTHERi
PTHR10411 PTHR10411, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01248 Ribosomal_L7Ae, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55315 SSF55315, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P24522-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTLEEFSAGE QKTERMDKVG DALEEVLSKA LSQRTITVGV YEAAKLLNVD
60 70 80 90 100
PDNVVLCLLA ADEDDDRDVA LQIHFTLIQA FCCENDINIL RVSNPGRLAE
110 120 130 140 150
LLLLETDAGP AASEGAEQPP DLHCVLVTNP HSSQWKDPAL SQLICFCRES
160
RYMDQWVPVI NLPER
Length:165
Mass (Da):18,336
Last modified:March 1, 1992 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF2ADC183F6C0F064
GO
Isoform 2 (identifier: P24522-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-49: RMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNV → S

Note: No experimental confirmation available.
Show »
Length:131
Mass (Da):14,622
Checksum:i63E9E606684A9AB3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A5JUZ3A5JUZ3_HUMAN
Growth arrest and DNA damage-induci...
GADD45A
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WZQ0A0A087WZQ0_HUMAN
Growth arrest and DNA damage-induci...
GADD45A
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITF9A0A3B3ITF9_HUMAN
Growth arrest and DNA damage-induci...
GADD45A
26Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04252315 – 49RMDKV…KLLNV → S in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L24498 Genomic DNA Translation: AAA72045.1
M60974 mRNA Translation: AAA35863.1
AY135686 Genomic DNA Translation: AAM88884.1
DQ008445 mRNA Translation: AAY25021.1
AK314991 mRNA Translation: BAG37487.1
AL136120 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06487.1
CH471059 Genomic DNA Translation: EAX06488.1
BC011757 mRNA Translation: AAH11757.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55605.1 [P24522-2]
CCDS640.1 [P24522-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A39617

NCBI Reference Sequences

More...
RefSeqi
NP_001186670.1, NM_001199741.1 [P24522-2]
NP_001186671.1, NM_001199742.1
NP_001915.1, NM_001924.3 [P24522-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.80409

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370985; ENSP00000360024; ENSG00000116717 [P24522-2]
ENST00000370986; ENSP00000360025; ENSG00000116717 [P24522-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1647

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1647

UCSC genome browser

More...
UCSCi
uc001ddz.3 human [P24522-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Wikipedia

GADD45A entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24498 Genomic DNA Translation: AAA72045.1
M60974 mRNA Translation: AAA35863.1
AY135686 Genomic DNA Translation: AAM88884.1
DQ008445 mRNA Translation: AAY25021.1
AK314991 mRNA Translation: BAG37487.1
AL136120 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06487.1
CH471059 Genomic DNA Translation: EAX06488.1
BC011757 mRNA Translation: AAH11757.1
CCDSiCCDS55605.1 [P24522-2]
CCDS640.1 [P24522-1]
PIRiA39617
RefSeqiNP_001186670.1, NM_001199741.1 [P24522-2]
NP_001186671.1, NM_001199742.1
NP_001915.1, NM_001924.3 [P24522-1]
UniGeneiHs.80409

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KG4NMR-A1-165[»]
DisProtiDP00704
ProteinModelPortaliP24522
SMRiP24522
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108014, 89 interactors
CORUMiP24522
DIPiDIP-24217N
IntActiP24522, 62 interactors
MINTiP24522
STRINGi9606.ENSP00000360025

PTM databases

iPTMnetiP24522
PhosphoSitePlusiP24522

Polymorphism and mutation databases

BioMutaiGADD45A
DMDMi120751

Proteomic databases

EPDiP24522
PaxDbiP24522
PeptideAtlasiP24522
PRIDEiP24522
ProteomicsDBi54209
54210 [P24522-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1647
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370985; ENSP00000360024; ENSG00000116717 [P24522-2]
ENST00000370986; ENSP00000360025; ENSG00000116717 [P24522-1]
GeneIDi1647
KEGGihsa:1647
UCSCiuc001ddz.3 human [P24522-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1647
DisGeNETi1647
EuPathDBiHostDB:ENSG00000116717.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GADD45A
HGNCiHGNC:4095 GADD45A
HPAiHPA053420
MIMi126335 gene
neXtProtiNX_P24522
OpenTargetsiENSG00000116717
PharmGKBiPA28510

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFHI Eukaryota
ENOG4111M8M LUCA
GeneTreeiENSGT00940000154140
HOGENOMiHOG000013221
HOVERGENiHBG051684
InParanoidiP24522
KOiK04402
OMAiQWVPIIN
OrthoDBi1517160at2759
PhylomeDBiP24522
TreeFamiTF300196

Enzyme and pathway databases

ReactomeiR-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
SIGNORiP24522

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GADD45A human
EvolutionaryTraceiP24522

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GADD45A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1647

Protein Ontology

More...
PROi
PR:P24522

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116717 Expressed in 231 organ(s), highest expression level in quadriceps femoris
CleanExiHS_GADD45A
ExpressionAtlasiP24522 baseline and differential
GenevisibleiP24522 HS

Family and domain databases

Gene3Di3.30.1330.30, 1 hit
InterProiView protein in InterPro
IPR024824 GADD45
IPR029064 L30e-like
IPR004038 Ribosomal_L7Ae/L30e/S12e/Gad45
PANTHERiPTHR10411 PTHR10411, 1 hit
PfamiView protein in Pfam
PF01248 Ribosomal_L7Ae, 1 hit
SUPFAMiSSF55315 SSF55315, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGA45A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P24522
Secondary accession number(s): Q5TCA7, Q5TCA8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: March 1, 1992
Last modified: January 16, 2019
This is version 156 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again