Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P24462 (CP3A7_HUMAN)

Entry version 191 (07 Apr 2021)
Sequence version 3 (12 Sep 2018)
Previous versions | rss
Add a publicationFeedback
Protein

Cytochrome P450 3A7

Gene

CYP3A7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes 3beta-hydroxyandrost-5-en-17-one (dehydroepiandrosterone, DHEA), a precursor in the biosynthesis of androgen and estrogen steroid hormones (PubMed:9555064, PubMed:17178770). Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1), particularly D-ring hydroxylated estrone at the C16-alpha position (PubMed:14559847, PubMed:12865317). Mainly hydroxylates all trans-retinoic acid (atRA) to 4-hydroxyretinoate and may play a role in atRA clearance during fetal development (PubMed:11093772). Also involved in the oxidative metabolism of xenobiotics including anticonvulsants (PubMed:9555064).5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

hemeBy similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=10 µM for estrone (16-alpha hydroxylation)1 Publication
  2. KM=10 µM for estrone (2-hydroxylation)1 Publication
  3. KM=25.3 µM for estrone (4-hydroxylation)1 Publication
  4. KM=33.5 µM for 17beta-estradiol (2-hydroxylation)1 Publication
  5. KM=15 µM for all-trans-retinoate (4-hydroxylation)1 Publication
  6. KM=5 µM for all-trans-retinoate (18-hydroxylation)1 Publication
  7. KM=14.8 µM for 3beta-hydroxyandrost-5-en-17-one (16-alpha hydroxylation)1 Publication
  8. KM=18.5 µM for 3beta-sulfooxy-androst-5-en-17-one (16-alpha hydroxylation)1 Publication
  1. Vmax=1423 pmol/min/nmol enzyme toward estrone (16-alpha hydroxylation)1 Publication
  2. Vmax=2109 pmol/min/nmol enzyme toward estrone (2-hydroxylation)1 Publication
  3. Vmax=328 pmol/min/nmol enzyme toward estrone (4-hydroxylation)1 Publication
  4. Vmax=616 pmol/min/nmol enzyme toward 17beta-estradiol (2-hydroxylation)1 Publication
  5. Vmax=1869 pmol/min/nmol enzyme toward all-trans-retinoate (4-hydroxylation)1 Publication
  6. Vmax=52 pmol/min/nmol enzyme toward all-trans-retinoate (18-hydroxylation)1 Publication
  7. Vmax=20.8 nmol/min/nmol enzyme toward 3beta-hydroxyandrost-5-en-17-one (16-alpha hydroxylation)1 Publication
  8. Vmax=6.5 nmol/min/nmol enzyme toward 3beta-sulfooxy-androst-5-en-17-one (16-alpha hydroxylation)1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: Steroid hormone biosynthesis

This protein is involved in Steroid hormone biosynthesis.3 Publications
View all proteins of this organism that are known to be involved in Steroid hormone biosynthesis.

Pathwayi: retinol metabolism

This protein is involved in the pathway retinol metabolism, which is part of Cofactor metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway retinol metabolism and in Cofactor metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi442Iron (heme axial ligand)By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
Biological processLipid biosynthesis, Lipid metabolism, Steroid biosynthesis
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		1.14.14.1, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P24462

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-211981, Xenobiotics

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P24462

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00912

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001324

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytochrome P450 3A71 Publication (EC:1.14.14.13 Publications)
Alternative name(s):
CYPIIIA7
Cytochrome P450-HFLA1 Publication
P450HLp21 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CYP3A71 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:2640, CYP3A7

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605340, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P24462

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000160870.12
HostDB:ENSG00000282301.1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi116N → S: Has no effect on catalytic activity. 1 Publication1
Mutagenesisi174H → D: Increases catalytic activity. 1 Publication1
Mutagenesisi214N → D: Increases catalytic activity. 1 Publication1
Mutagenesisi224K → T: Reduces affinity for substrate and catalytic efficiency. 1 Publication1
Mutagenesisi244K → E: Reduces affinity for substrate and catalytic efficiency. 1 Publication1
Mutagenesisi262K → E: Has no effect on catalytic activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		100861540
1551

Open Targets

More...OpenTargetsi		ENSG00000160870
ENSG00000282301

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA122

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P24462, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3341582

Drug and drug target database

More...DrugBanki		DB11703, Acalabrutinib
DB00802, Alfentanil
DB00404, Alprazolam
DB13141, Ambroxol acefyllinate
DB01238, Aripiprazole
DB14185, Aripiprazole lauroxil
DB00637, Astemizole
DB01076, Atorvastatin
DB00443, Betamethasone
DB12267, Brigatinib
DB01222, Budesonide
DB00921, Buprenorphine
DB00490, Buspirone
DB09061, Cannabidiol
DB00439, Cerivastatin
DB00446, Chloramphenicol
DB01114, Chlorpheniramine
DB01166, Cilostazol
DB00537, Ciprofloxacin
DB00604, Cisapride
DB00257, Clotrimazole
DB09065, Cobicistat
DB12483, Copanlisib
DB08865, Crizotinib
DB09102, Daclatasvir
DB00250, Dapsone
DB00705, Delavirdine
DB01234, Dexamethasone
DB14649, Dexamethasone acetate
DB00514, Dextromethorphan
DB11994, Diacerein
DB00829, Diazepam
DB00343, Diltiazem
DB01248, Docetaxel
DB08930, Dolutegravir
DB01184, Domperidone
DB00625, Efavirenz
DB11979, Elagolix
DB11574, Elbasvir
DB00199, Erythromycin
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB00593, Ethosuximide
DB01023, Felodipine
DB00813, Fentanyl
DB01216, Finasteride
DB13867, Fluticasone
DB08906, Fluticasone furoate
DB00588, Fluticasone propionate
DB00176, Fluvoxamine
DB12307, Foretinib
DB06730, Gestodene
DB13879, Glecaprevir
DB01016, Glyburide
DB00502, Haloperidol
DB00741, Hydrocortisone
DB14538, Hydrocortisone aceponate
DB14539, Hydrocortisone acetate
DB14540, Hydrocortisone butyrate
DB14541, Hydrocortisone cypionate
DB14542, Hydrocortisone phosphate
DB14543, Hydrocortisone probutate
DB14544, Hydrocortisone valerate
DB09054, Idelalisib
DB04946, Iloperidone
DB00619, Imatinib
DB00458, Imipramine
DB00224, Indinavir
DB00762, Irinotecan
DB11757, Istradefylline
DB01167, Itraconazole
DB11951, Lemborexant
DB00528, Lercanidipine
DB12070, Letermovir
DB01227, Levacetylmethadol
DB00281, Lidocaine
DB06448, Lonafarnib
DB01601, Lopinavir
DB12130, Lorlatinib
DB09212, Loxoprofen
DB00643, Mebendazole
DB14009, Medical Cannabis
DB00333, Methadone
DB00959, Methylprednisolone
DB00916, Metronidazole
DB01388, Mibefradil
DB00683, Midazolam
DB06595, Midostaurin
DB11792, Mirodenafil
DB09205, Moxisylyte
DB11605, Myrrh
DB14011, Nabiximols
DB11691, Naldemedine
DB00731, Nateglinide
DB01149, Nefazodone
DB00220, Nelfinavir
DB00238, Nevirapine
DB00401, Nisoldipine
DB01054, Nitrendipine
DB00334, Olanzapine
DB09568, Omega-3-carboxylic acids
DB00904, Ondansetron
DB06412, Oxymetholone
DB01229, Paclitaxel
DB00780, Phenelzine
DB01174, Phenobarbital
DB00252, Phenytoin
DB13878, Pibrentasvir
DB01100, Pimozide
DB01708, Prasterone
DB05804, Prasterone sulfate
DB01058, Praziquantel
DB14631, Prednisolone phosphate
DB00635, Prednisone
DB00396, Progesterone
DB00571, Propranolol
DB01224, Quetiapine
DB00908, Quinidine
DB00468, Quinine
DB11853, Relugolix
DB00409, Remoxipride
DB13174, Rhein
DB01045, Rifampicin
DB01201, Rifapentine
DB15305, Risdiplam
DB00503, Ritonavir
DB12332, Rucaparib
DB00938, Salmeterol
DB01232, Saquinavir
DB15685, Selpercatinib
DB06731, Seproxetine
DB00203, Sildenafil
DB00877, Sirolimus
DB00398, Sorafenib
DB01268, Sunitinib
DB00675, Tamoxifen
DB12887, Tazemetostat
DB06287, Temsirolimus
DB00342, Terfenadine
DB00624, Testosterone
DB13943, Testosterone cypionate
DB13944, Testosterone enanthate
DB13946, Testosterone undecanoate
DB00599, Thiopental
DB00656, Trazodone
DB00755, Tretinoin
DB00620, Triamcinolone
DB00897, Triazolam
DB00197, Troglitazone
DB13179, Troleandomycin
DB11652, Tucatinib
DB00541, Vincristine
DB00582, Voriconazole
DB00962, Zaleplon
DB15035, Zanubrutinib

DrugCentral

More...DrugCentrali		P24462

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CYP3A7

Domain mapping of disease mutations (DMDM)

More...DMDMi		90110014

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000517901 – 503Cytochrome P450 3A7Add BLAST503

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P24462

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P24462

PeptideAtlas

More...PeptideAtlasi		P24462

PRoteomics IDEntifications database

More...PRIDEi		P24462

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54205 [P24462-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P24462

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P24462

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in fetal liver (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000160870, Expressed in liver and 131 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P24462, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P24462, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000160870, Tissue enriched (liver)
ENSG00000282301, Tissue enriched (liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107930, 4 interactors

Protein interaction database and analysis system

More...IntActi		P24462, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000480571

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P24462

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P24462, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P24462

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0158, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182958

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001570_5_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P24462

Identification of Orthologs from Complete Genome Data

More...OMAi		MAYHEMR

Database of Orthologous Groups

More...OrthoDBi		467733at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P24462

TreeFam database of animal gene trees

More...TreeFami		TF105087

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.630.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR008072, Cyt_P450_E_CYP3A
IPR002402, Cyt_P450_E_grp-II
IPR036396, Cyt_P450_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00067, p450, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00464, EP450II
PR01689, EP450IICYP3A
PR00385, P450

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48264, SSF48264, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P24462-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA 
        60         70         80         90        100
LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS 
       110        120        130        140        150
VFTNRRPFGP VGFMKNAISI AEDEEWKRIR SLLSPTFTSG KLKEMVPIIA 
       160        170        180        190        200
QYGDVLVRNL RREAETGKPV TLKHVFGAYS MDVITSTSFG VSIDSLNNPQ 
       210        220        230        240        250
DPFVENTKKL LRFNPLDPFV LSIKVFPFLT PILEALNITV FPRKVISFLT 
       260        270        280        290        300
KSVKQIKEGR LKETQKHRVD FLQLMIDSQN SKDSETHKAL SDLELMAQSI 
       310        320        330        340        350
IFIFAGYETT SSVLSFIIYE LATHPDVQQK VQKEIDTVLP NKAPPTYDTV 
       360        370        380        390        400
LQLEYLDMVV NETLRLFPVA MRLERVCKKD VEINGMFIPK GVVVMIPSYV 
       410        420        430        440        450
LHHDPKYWTE PEKFLPERFS KKNKDNIDPY IYTPFGSGPR NCIGMRFALV 
       460        470        480        490        500
NMKLALVRVL QNFSFKPCKE TQIPLKLRFG GLLLTEKPIV LKAESRDETV 

SGA
Length:503
Mass (Da):57,470
Last modified:September 12, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i087CCEED9BAC314C
GO
Isoform 2 (identifier: P24462-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     500-503: VSGA → FVDMEPIHMDFLRSLAFQGPHLCFFWELLCPTIRSR

Show »
Length:535
Mass (Da):61,492
Checksum:iD42210E526CE1614
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05556471V → A. Corresponds to variant dbSNP:rs45580339EnsemblClinVar.1
Natural variantiVAR_020124409T → R. Corresponds to variant dbSNP:rs2257401Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055577500 – 503VSGA → FVDMEPIHMDFLRSLAFQGP HLCFFWELLCPTIRSR in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D00408 mRNA Translation: BAA00310.1
AF315325 mRNA Translation: AAG48618.1
AF280107 Genomic DNA Translation: AAG32289.1
CH236956 Genomic DNA Translation: EAL23867.1
CH471091 Genomic DNA Translation: EAW76637.1
BC067436 mRNA Translation: AAH67436.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5673.1 [P24462-1]

Protein sequence database of the Protein Information Resource

More...PIRi		JX0062

NCBI Reference Sequences

More...RefSeqi		NP_000756.3, NM_000765.4 [P24462-1]
NP_001243426.2, NM_001256497.2 [P24462-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000336374; ENSP00000337450; ENSG00000160870 [P24462-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		100861540
1551

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:100861540
hsa:1551

UCSC genome browser

More...UCSCi		uc003uru.4, human [P24462-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP3A7 alleles

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D00408 mRNA Translation: BAA00310.1
AF315325 mRNA Translation: AAG48618.1
AF280107 Genomic DNA Translation: AAG32289.1
CH236956 Genomic DNA Translation: EAL23867.1
CH471091 Genomic DNA Translation: EAW76637.1
BC067436 mRNA Translation: AAH67436.1
CCDSiCCDS5673.1 [P24462-1]
PIRiJX0062
RefSeqiNP_000756.3, NM_000765.4 [P24462-1]
NP_001243426.2, NM_001256497.2 [P24462-2]

3D structure databases

SMRiP24462
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi107930, 4 interactors
IntActiP24462, 1 interactor
STRINGi9606.ENSP00000480571

Chemistry databases

BindingDBiP24462
ChEMBLiCHEMBL3341582
DrugBankiDB11703, Acalabrutinib
DB00802, Alfentanil
DB00404, Alprazolam
DB13141, Ambroxol acefyllinate
DB01238, Aripiprazole
DB14185, Aripiprazole lauroxil
DB00637, Astemizole
DB01076, Atorvastatin
DB00443, Betamethasone
DB12267, Brigatinib
DB01222, Budesonide
DB00921, Buprenorphine
DB00490, Buspirone
DB09061, Cannabidiol
DB00439, Cerivastatin
DB00446, Chloramphenicol
DB01114, Chlorpheniramine
DB01166, Cilostazol
DB00537, Ciprofloxacin
DB00604, Cisapride
DB00257, Clotrimazole
DB09065, Cobicistat
DB12483, Copanlisib
DB08865, Crizotinib
DB09102, Daclatasvir
DB00250, Dapsone
DB00705, Delavirdine
DB01234, Dexamethasone
DB14649, Dexamethasone acetate
DB00514, Dextromethorphan
DB11994, Diacerein
DB00829, Diazepam
DB00343, Diltiazem
DB01248, Docetaxel
DB08930, Dolutegravir
DB01184, Domperidone
DB00625, Efavirenz
DB11979, Elagolix
DB11574, Elbasvir
DB00199, Erythromycin
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB00593, Ethosuximide
DB01023, Felodipine
DB00813, Fentanyl
DB01216, Finasteride
DB13867, Fluticasone
DB08906, Fluticasone furoate
DB00588, Fluticasone propionate
DB00176, Fluvoxamine
DB12307, Foretinib
DB06730, Gestodene
DB13879, Glecaprevir
DB01016, Glyburide
DB00502, Haloperidol
DB00741, Hydrocortisone
DB14538, Hydrocortisone aceponate
DB14539, Hydrocortisone acetate
DB14540, Hydrocortisone butyrate
DB14541, Hydrocortisone cypionate
DB14542, Hydrocortisone phosphate
DB14543, Hydrocortisone probutate
DB14544, Hydrocortisone valerate
DB09054, Idelalisib
DB04946, Iloperidone
DB00619, Imatinib
DB00458, Imipramine
DB00224, Indinavir
DB00762, Irinotecan
DB11757, Istradefylline
DB01167, Itraconazole
DB11951, Lemborexant
DB00528, Lercanidipine
DB12070, Letermovir
DB01227, Levacetylmethadol
DB00281, Lidocaine
DB06448, Lonafarnib
DB01601, Lopinavir
DB12130, Lorlatinib
DB09212, Loxoprofen
DB00643, Mebendazole
DB14009, Medical Cannabis
DB00333, Methadone
DB00959, Methylprednisolone
DB00916, Metronidazole
DB01388, Mibefradil
DB00683, Midazolam
DB06595, Midostaurin
DB11792, Mirodenafil
DB09205, Moxisylyte
DB11605, Myrrh
DB14011, Nabiximols
DB11691, Naldemedine
DB00731, Nateglinide
DB01149, Nefazodone
DB00220, Nelfinavir
DB00238, Nevirapine
DB00401, Nisoldipine
DB01054, Nitrendipine
DB00334, Olanzapine
DB09568, Omega-3-carboxylic acids
DB00904, Ondansetron
DB06412, Oxymetholone
DB01229, Paclitaxel
DB00780, Phenelzine
DB01174, Phenobarbital
DB00252, Phenytoin
DB13878, Pibrentasvir
DB01100, Pimozide
DB01708, Prasterone
DB05804, Prasterone sulfate
DB01058, Praziquantel
DB14631, Prednisolone phosphate
DB00635, Prednisone
DB00396, Progesterone
DB00571, Propranolol
DB01224, Quetiapine
DB00908, Quinidine
DB00468, Quinine
DB11853, Relugolix
DB00409, Remoxipride
DB13174, Rhein
DB01045, Rifampicin
DB01201, Rifapentine
DB15305, Risdiplam
DB00503, Ritonavir
DB12332, Rucaparib
DB00938, Salmeterol
DB01232, Saquinavir
DB15685, Selpercatinib
DB06731, Seproxetine
DB00203, Sildenafil
DB00877, Sirolimus
DB00398, Sorafenib
DB01268, Sunitinib
DB00675, Tamoxifen
DB12887, Tazemetostat
DB06287, Temsirolimus
DB00342, Terfenadine
DB00624, Testosterone
DB13943, Testosterone cypionate
DB13944, Testosterone enanthate
DB13946, Testosterone undecanoate
DB00599, Thiopental
DB00656, Trazodone
DB00755, Tretinoin
DB00620, Triamcinolone
DB00897, Triazolam
DB00197, Troglitazone
DB13179, Troleandomycin
DB11652, Tucatinib
DB00541, Vincristine
DB00582, Voriconazole
DB00962, Zaleplon
DB15035, Zanubrutinib
DrugCentraliP24462
SwissLipidsiSLP:000001324

PTM databases

iPTMnetiP24462
PhosphoSitePlusiP24462

Genetic variation databases

BioMutaiCYP3A7
DMDMi90110014

Proteomic databases

MassIVEiP24462
PaxDbiP24462
PeptideAtlasiP24462
PRIDEiP24462
ProteomicsDBi54205 [P24462-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		16242, 233 antibodies

Genome annotation databases

EnsembliENST00000336374; ENSP00000337450; ENSG00000160870 [P24462-1]
GeneIDi100861540
1551
KEGGihsa:100861540
hsa:1551
UCSCiuc003uru.4, human [P24462-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		100861540
1551
DisGeNETi100861540
1551

GeneCards: human genes, protein and diseases

More...GeneCardsi		CYP3A7
HGNCiHGNC:2640, CYP3A7
HPAiENSG00000160870, Tissue enriched (liver)
ENSG00000282301, Tissue enriched (liver)
MIMi605340, gene
neXtProtiNX_P24462
OpenTargetsiENSG00000160870
ENSG00000282301
PharmGKBiPA122
VEuPathDBiHostDB:ENSG00000160870.12
HostDB:ENSG00000282301.1

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0158, Eukaryota
GeneTreeiENSGT00950000182958
HOGENOMiCLU_001570_5_2_1
InParanoidiP24462
OMAiMAYHEMR
OrthoDBi467733at2759
PhylomeDBiP24462
TreeFamiTF105087

Enzyme and pathway databases

UniPathwayiUPA00912
BRENDAi1.14.14.1, 2681
PathwayCommonsiP24462
ReactomeiR-HSA-211981, Xenobiotics
SABIO-RKiP24462

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		100861540, 0 hits in 90 CRISPR screens
1551, 2 hits in 936 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CYP3A7
PharosiP24462, Tclin

Protein Ontology

More...PROi		PR:P24462
RNActiP24462, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000160870, Expressed in liver and 131 other tissues
ExpressionAtlasiP24462, baseline and differential
GenevisibleiP24462, HS

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR008072, Cyt_P450_E_CYP3A
IPR002402, Cyt_P450_E_grp-II
IPR036396, Cyt_P450_sf
PfamiView protein in Pfam
PF00067, p450, 1 hit
PRINTSiPR00464, EP450II
PR01689, EP450IICYP3A
PR00385, P450
SUPFAMiSSF48264, SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCP3A7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P24462
Secondary accession number(s): A4D288, Q9H241
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: September 12, 2018
Last modified: April 7, 2021
This is version 191 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again