Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome P450 3A7

Gene

CYP3A7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Catalytic activityi

RH + [reduced NADPH--hemoprotein reductase] + O2 = ROH + [oxidized NADPH--hemoprotein reductase] + H2O.

Cofactori

hemeBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi442Iron (heme axial ligand)By similarity1

GO - Molecular functioni

  • aromatase activity Source: UniProtKB-EC
  • estrogen 16-alpha-hydroxylase activity Source: BHF-UCL
  • heme binding Source: InterPro
  • iron ion binding Source: InterPro
  • monooxygenase activity Source: UniProtKB
  • oxygen binding Source: ProtInc
  • steroid hydroxylase activity Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BRENDAi1.14.14.1 2681
ReactomeiR-HSA-211981 Xenobiotics

Chemistry databases

SwissLipidsiSLP:000001324

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 3A7Curated (EC:1.14.14.1)
Alternative name(s):
CYPIIIA7
Cytochrome P450-HFLA
Gene namesi
Name:CYP3A7Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000160870.12
HostDB:ENSG00000282301.1
HGNCiHGNC:2640 CYP3A7
MIMi605340 gene
neXtProtiNX_P24462

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

DisGeNETi100861540
1551
PharmGKBiPA122

Chemistry databases

ChEMBLiCHEMBL3341582
DrugBankiDB00802 Alfentanil
DB00404 Alprazolam
DB01424 Aminophenazone
DB01118 Amiodarone
DB00381 Amlodipine
DB00673 Aprepitant
DB01238 Aripiprazole
DB00637 Astemizole
DB01076 Atorvastatin
DB00921 Buprenorphine
DB00490 Buspirone
DB00201 Caffeine
DB00564 Carbamazepine
DB00439 Cerivastatin
DB00446 Chloramphenicol
DB01114 Chlorphenamine
DB01166 Cilostazol
DB00501 Cimetidine
DB00537 Ciprofloxacin
DB00604 Cisapride
DB01211 Clarithromycin
DB00257 Clotrimazole
DB05239 Cobimetinib
DB00907 Cocaine
DB00318 Codeine
DB00531 Cyclophosphamide
DB00091 Cyclosporine
DB09102 Daclatasvir
DB00250 Dapsone
DB05804 dehydroepiandrosterone sulfate
DB00705 Delavirdine
DB01234 Dexamethasone
DB00514 Dextromethorphan
DB00647 Dextropropoxyphene
DB00829 Diazepam
DB00343 Diltiazem
DB01248 Docetaxel
DB08930 Dolutegravir
DB01184 Domperidone
DB00700 Eplerenone
DB00199 Erythromycin
DB00783 Estradiol
DB00593 Ethosuximide
DB01466 Ethylmorphine
DB01023 Felodipine
DB00813 Fentanyl
DB01216 Finasteride
DB00196 Fluconazole
DB00588 Fluticasone Propionate
DB00176 Fluvoxamine
DB06730 Gestodene
DB00502 Haloperidol
DB00741 Hydrocortisone
DB01181 Ifosfamide
DB04946 Iloperidone
DB00619 Imatinib
DB00458 Imipramine
DB00224 Indinavir
DB00762 Irinotecan
DB01167 Itraconazole
DB01026 Ketoconazole
DB00528 Lercanidipine
DB01227 Levomethadyl Acetate
DB00281 Lidocaine
DB00227 Lovastatin
DB00333 Methadone
DB01388 Mibefradil
DB00683 Midazolam
DB00834 Mifepristone
DB00731 Nateglinide
DB01149 Nefazodone
DB00220 Nelfinavir
DB01115 Nifedipine
DB00401 Nisoldipine
DB01054 Nitrendipine
DB00717 Norethisterone
DB01059 Norfloxacin
DB00904 Ondansetron
DB00842 Oxazepam
DB00497 Oxycodone
DB01229 Paclitaxel
DB00780 Phenelzine
DB01174 Phenobarbital
DB00252 Phenytoin
DB01100 Pimozide
DB01708 Prasterone
DB01058 Praziquantel
DB00396 Progesterone
DB09396 Propoxyphene napsylate
DB00571 Propranolol
DB01224 Quetiapine
DB00908 Quinidine
DB00468 Quinine
DB01045 Rifampicin
DB01201 Rifapentine
DB00734 Risperidone
DB00503 Ritonavir
DB00938 Salmeterol
DB01232 Saquinavir
DB06731 Seproxetine
DB00203 Sildenafil
DB00641 Simvastatin
DB00877 Sirolimus
DB00398 Sorafenib
DB01268 Sunitinib
DB00864 Tacrolimus
DB00675 Tamoxifen
DB00976 Telithromycin
DB06287 Temsirolimus
DB00342 Terfenadine
DB00624 Testosterone
DB00656 Trazodone
DB00755 Tretinoin
DB00897 Triazolam
DB00197 Troglitazone
DB00661 Verapamil
DB00541 Vincristine
DB00582 Voriconazole
DB00943 Zalcitabine
DB00962 Zaleplon
DB00246 Ziprasidone
DB00425 Zolpidem

Polymorphism and mutation databases

BioMutaiCYP3A7
DMDMi90110014

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000517901 – 503Cytochrome P450 3A7Add BLAST503

Proteomic databases

MaxQBiP24462
PaxDbiP24462
PeptideAtlasiP24462
PRIDEiP24462
ProteomicsDBi54205

PTM databases

iPTMnetiP24462
PhosphoSitePlusiP24462

Expressioni

Inductioni

P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

Gene expression databases

BgeeiENSG00000160870 Expressed in 99 organ(s), highest expression level in liver
CleanExiHS_CYP3A7
GenevisibleiP24462 HS

Organism-specific databases

HPAiHPA072245

Interactioni

Protein-protein interaction databases

BioGridi107930, 4 interactors
STRINGi9606.ENSP00000337450

Chemistry databases

BindingDBiP24462

Structurei

3D structure databases

ProteinModelPortaliP24462
SMRiP24462
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGiKOG0158 Eukaryota
COG2124 LUCA
HOGENOMiHOG000039127
HOVERGENiHBG108567
InParanoidiP24462
KOiK17691
OrthoDBiEOG091G0JNC
PhylomeDBiP24462
TreeFamiTF105087

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128 Cyt_P450
IPR017972 Cyt_P450_CS
IPR008072 Cyt_P450_E_CYP3A
IPR002402 Cyt_P450_E_grp-II
IPR036396 Cyt_P450_sf
PfamiView protein in Pfam
PF00067 p450, 1 hit
PRINTSiPR00464 EP450II
PR01689 EP450IICYP3A
PR00385 P450
SUPFAMiSSF48264 SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086 CYTOCHROME_P450, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: P24462-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA
60 70 80 90 100
LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS
110 120 130 140 150
VFTNRRPFGP VGFMKNAISI AEDEEWKRIR SLLSPTFTSG KLKEMVPIIA
160 170 180 190 200
QYGDVLVRNL RREAETGKPV TLKHVFGAYS MDVITSTSFG VSIDSLNNPQ
210 220 230 240 250
DPFVENTKKL LRFNPLDPFV LSIKVFPFLT PILEALNITV FPRKVISFLT
260 270 280 290 300
KSVKQIKEGR LKETQKHRVD FLQLMIDSQN SKDSETHKAL SDLELMAQSI
310 320 330 340 350
IFIFAGYETT SSVLSFIIYE LATHPDVQQK VQKEIDTVLP NKAPPTYDTV
360 370 380 390 400
LQLEYLDMVV NETLRLFPVA MRLERVCKKD VEINGMFIPK GVVVMIPSYV
410 420 430 440 450
LHHDPKYWTE PEKFLPERFS KKNKDNIDPY IYTPFGSGPR NCIGMRFALV
460 470 480 490 500
NMKLALVRVL QNFSFKPCKE TQIPLKLRFG GLLLTEKPIV LKAESRDETV

SGA
Length:503
Mass (Da):57,470
Last modified:September 12, 2018 - v3
Checksum:i087CCEED9BAC314C
GO
Isoform 2 (identifier: P24462-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     500-503: VSGA → FVDMEPIHMDFLRSLAFQGPHLCFFWELLCPTIRSR

Show »
Length:535
Mass (Da):61,492
Checksum:iD42210E526CE1614
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WV96A0A087WV96_HUMAN
Cytochrome P450 3A7
CYP3A7
503Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05556471V → A. Corresponds to variant dbSNP:rs45580339Ensembl.1
Natural variantiVAR_020124409T → R. Corresponds to variant dbSNP:rs2257401Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055577500 – 503VSGA → FVDMEPIHMDFLRSLAFQGP HLCFFWELLCPTIRSR in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D00408 mRNA Translation: BAA00310.1
AF315325 mRNA Translation: AAG48618.1
AF280107 Genomic DNA Translation: AAG32289.1
CH236956 Genomic DNA Translation: EAL23867.1
CH471091 Genomic DNA Translation: EAW76637.1
BC067436 mRNA Translation: AAH67436.1
CCDSiCCDS5673.1 [P24462-1]
PIRiJX0062
RefSeqiNP_000756.3, NM_000765.4
NP_001243426.2, NM_001256497.2
UniGeneiHs.111944

Genome annotation databases

EnsembliENST00000336374; ENSP00000337450; ENSG00000160870
ENST00000611620; ENSP00000480571; ENSG00000160870
GeneIDi100861540
1551
KEGGihsa:100861540
hsa:1551
UCSCiuc003uru.4 human [P24462-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP3A7 alleles

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D00408 mRNA Translation: BAA00310.1
AF315325 mRNA Translation: AAG48618.1
AF280107 Genomic DNA Translation: AAG32289.1
CH236956 Genomic DNA Translation: EAL23867.1
CH471091 Genomic DNA Translation: EAW76637.1
BC067436 mRNA Translation: AAH67436.1
CCDSiCCDS5673.1 [P24462-1]
PIRiJX0062
RefSeqiNP_000756.3, NM_000765.4
NP_001243426.2, NM_001256497.2
UniGeneiHs.111944

3D structure databases

ProteinModelPortaliP24462
SMRiP24462
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107930, 4 interactors
STRINGi9606.ENSP00000337450

Chemistry databases

BindingDBiP24462
ChEMBLiCHEMBL3341582
DrugBankiDB00802 Alfentanil
DB00404 Alprazolam
DB01424 Aminophenazone
DB01118 Amiodarone
DB00381 Amlodipine
DB00673 Aprepitant
DB01238 Aripiprazole
DB00637 Astemizole
DB01076 Atorvastatin
DB00921 Buprenorphine
DB00490 Buspirone
DB00201 Caffeine
DB00564 Carbamazepine
DB00439 Cerivastatin
DB00446 Chloramphenicol
DB01114 Chlorphenamine
DB01166 Cilostazol
DB00501 Cimetidine
DB00537 Ciprofloxacin
DB00604 Cisapride
DB01211 Clarithromycin
DB00257 Clotrimazole
DB05239 Cobimetinib
DB00907 Cocaine
DB00318 Codeine
DB00531 Cyclophosphamide
DB00091 Cyclosporine
DB09102 Daclatasvir
DB00250 Dapsone
DB05804 dehydroepiandrosterone sulfate
DB00705 Delavirdine
DB01234 Dexamethasone
DB00514 Dextromethorphan
DB00647 Dextropropoxyphene
DB00829 Diazepam
DB00343 Diltiazem
DB01248 Docetaxel
DB08930 Dolutegravir
DB01184 Domperidone
DB00700 Eplerenone
DB00199 Erythromycin
DB00783 Estradiol
DB00593 Ethosuximide
DB01466 Ethylmorphine
DB01023 Felodipine
DB00813 Fentanyl
DB01216 Finasteride
DB00196 Fluconazole
DB00588 Fluticasone Propionate
DB00176 Fluvoxamine
DB06730 Gestodene
DB00502 Haloperidol
DB00741 Hydrocortisone
DB01181 Ifosfamide
DB04946 Iloperidone
DB00619 Imatinib
DB00458 Imipramine
DB00224 Indinavir
DB00762 Irinotecan
DB01167 Itraconazole
DB01026 Ketoconazole
DB00528 Lercanidipine
DB01227 Levomethadyl Acetate
DB00281 Lidocaine
DB00227 Lovastatin
DB00333 Methadone
DB01388 Mibefradil
DB00683 Midazolam
DB00834 Mifepristone
DB00731 Nateglinide
DB01149 Nefazodone
DB00220 Nelfinavir
DB01115 Nifedipine
DB00401 Nisoldipine
DB01054 Nitrendipine
DB00717 Norethisterone
DB01059 Norfloxacin
DB00904 Ondansetron
DB00842 Oxazepam
DB00497 Oxycodone
DB01229 Paclitaxel
DB00780 Phenelzine
DB01174 Phenobarbital
DB00252 Phenytoin
DB01100 Pimozide
DB01708 Prasterone
DB01058 Praziquantel
DB00396 Progesterone
DB09396 Propoxyphene napsylate
DB00571 Propranolol
DB01224 Quetiapine
DB00908 Quinidine
DB00468 Quinine
DB01045 Rifampicin
DB01201 Rifapentine
DB00734 Risperidone
DB00503 Ritonavir
DB00938 Salmeterol
DB01232 Saquinavir
DB06731 Seproxetine
DB00203 Sildenafil
DB00641 Simvastatin
DB00877 Sirolimus
DB00398 Sorafenib
DB01268 Sunitinib
DB00864 Tacrolimus
DB00675 Tamoxifen
DB00976 Telithromycin
DB06287 Temsirolimus
DB00342 Terfenadine
DB00624 Testosterone
DB00656 Trazodone
DB00755 Tretinoin
DB00897 Triazolam
DB00197 Troglitazone
DB00661 Verapamil
DB00541 Vincristine
DB00582 Voriconazole
DB00943 Zalcitabine
DB00962 Zaleplon
DB00246 Ziprasidone
DB00425 Zolpidem
SwissLipidsiSLP:000001324

PTM databases

iPTMnetiP24462
PhosphoSitePlusiP24462

Polymorphism and mutation databases

BioMutaiCYP3A7
DMDMi90110014

Proteomic databases

MaxQBiP24462
PaxDbiP24462
PeptideAtlasiP24462
PRIDEiP24462
ProteomicsDBi54205

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336374; ENSP00000337450; ENSG00000160870
ENST00000611620; ENSP00000480571; ENSG00000160870
GeneIDi100861540
1551
KEGGihsa:100861540
hsa:1551
UCSCiuc003uru.4 human [P24462-1]

Organism-specific databases

CTDi100861540
1551
DisGeNETi100861540
1551
EuPathDBiHostDB:ENSG00000160870.12
HostDB:ENSG00000282301.1
GeneCardsiCYP3A7
CYP3A7-CYP3A51P
HGNCiHGNC:2640 CYP3A7
HPAiHPA072245
MIMi605340 gene
neXtProtiNX_P24462
PharmGKBiPA122
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0158 Eukaryota
COG2124 LUCA
HOGENOMiHOG000039127
HOVERGENiHBG108567
InParanoidiP24462
KOiK17691
OrthoDBiEOG091G0JNC
PhylomeDBiP24462
TreeFamiTF105087

Enzyme and pathway databases

BRENDAi1.14.14.1 2681
ReactomeiR-HSA-211981 Xenobiotics

Miscellaneous databases

GeneWikiiCYP3A7
PROiPR:P24462
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000160870 Expressed in 99 organ(s), highest expression level in liver
CleanExiHS_CYP3A7
GenevisibleiP24462 HS

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128 Cyt_P450
IPR017972 Cyt_P450_CS
IPR008072 Cyt_P450_E_CYP3A
IPR002402 Cyt_P450_E_grp-II
IPR036396 Cyt_P450_sf
PfamiView protein in Pfam
PF00067 p450, 1 hit
PRINTSiPR00464 EP450II
PR01689 EP450IICYP3A
PR00385 P450
SUPFAMiSSF48264 SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086 CYTOCHROME_P450, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCP3A7_HUMAN
AccessioniPrimary (citable) accession number: P24462
Secondary accession number(s): A4D288, Q9H241
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: September 12, 2018
Last modified: September 12, 2018
This is version 170 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again