Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Follicle-stimulating hormone receptor

Gene

FSHR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

G protein-coupled receptor for follitropin, the follicle-stimulating hormone (PubMed:11847099, PubMed:24058690, PubMed:24692546). Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways (PubMed:24058690).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • follicle-stimulating hormone receptor activity Source: UniProtKB
  • G protein-coupled peptide receptor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-375281 Hormone ligand-binding receptors
R-HSA-418555 G alpha (s) signalling events

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P23945

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P23945

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.A.14.1.5 the g-protein-coupled receptor (gpcr) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Follicle-stimulating hormone receptor
Short name:
FSH-R
Alternative name(s):
Follitropin receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FSHR
Synonyms:LGR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000170820.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3969 FSHR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
136435 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P23945

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini18 – 366ExtracellularSequence analysisAdd BLAST349
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei367 – 387Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini388 – 398CytoplasmicSequence analysisAdd BLAST11
Transmembranei399 – 421Helical; Name=2Sequence analysisAdd BLAST23
Topological domaini422 – 443ExtracellularSequence analysisAdd BLAST22
Transmembranei444 – 465Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini466 – 485CytoplasmicSequence analysisAdd BLAST20
Transmembranei486 – 508Helical; Name=4Sequence analysisAdd BLAST23
Topological domaini509 – 528ExtracellularSequence analysisAdd BLAST20
Transmembranei529 – 550Helical; Name=5Sequence analysisAdd BLAST22
Topological domaini551 – 573CytoplasmicSequence analysisAdd BLAST23
Transmembranei574 – 597Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini598 – 608ExtracellularSequence analysisAdd BLAST11
Transmembranei609 – 630Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini631 – 695CytoplasmicSequence analysisAdd BLAST65

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Ovarian dysgenesis 1 (ODG1)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disease characterized by primary amenorrhea, variable development of secondary sex characteristics, poorly developed streak ovaries, and high serum levels of follicle-stimulating hormone (FSH) and luteinizing hormone (LH).
See also OMIM:233300
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_018045160I → T in ODG1; impairs cell surface expression. 1 Publication1
Natural variantiVAR_018046189A → V in ODG1; very frequent in the Finnish population. 2 Publications1
Natural variantiVAR_039280224D → V in ODG1; FSH binding is barely detectable; impaired targeting to the cell membrane; adenylate cyclase stimulation by FSH is 4 +-2% residual activity. 1 Publication1
Natural variantiVAR_039281348P → R in ODG1. 1 Publication1
Natural variantiVAR_018047419A → T in ODG1. 1 Publication1
Natural variantiVAR_039283519P → T in ODG1; totally impairs adenylate cyclase stimulation in vitro; alters the cell surface targeting of the receptor which remains trapped intracellularly. 1 Publication1
Natural variantiVAR_018048573R → C in ODG1; alters signal transduction of the receptor; adenylate cyclase stimulation by FSH is 24 +-4% residual activity. 2 Publications1
Natural variantiVAR_039286601L → V in ODG1; binds FSH with a similar affinity than the wild-type receptor; adenylate cyclase stimulation by FSH is 12 +-3% residual activity. 1 Publication1
Ovarian hyperstimulation syndrome (OHSS)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionDisorder which occurs either spontaneously or most often as an iatrogenic complication of ovarian stimulation treatments for in vitro fertilization. The clinical manifestations vary from abdominal distention and discomfort to potentially life-threatening, massive ovarian enlargement and capillary leak with fluid sequestration. Pathologic features of this syndrome include the presence of multiple serous and hemorrhagic follicular cysts lined by luteinized cells, a condition called hyperreactio luteinalis.
See also OMIM:608115
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039279128S → Y in OHSS; displays increase in affinity and sensitivity toward hCG and does not show any constitutive activity nor promiscuous activation by TSH. 1 Publication1
Natural variantiVAR_039282449T → A in OHSS; increase of receptor sensitivity to both hCG and TSH together with an increase in basal activity. 1 Publication1
Natural variantiVAR_017244449T → I in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928870EnsemblClinVar.1
Natural variantiVAR_074535512M → I in OHSS; inhibits activation of PI3K/AKT signaling pathway; reduces cAMP production; no effect on ERK1/2 signaling pathway activation. 1 Publication1
Natural variantiVAR_074536514V → A in OHSS; increases cell surface expression; no effect on hormone binding; increases signaling activity. 1 Publication1
Natural variantiVAR_039284545I → T in OHSS; displays promiscuous activation by both hCG and TSH together with detectable constitutive activity. 1 Publication1
Natural variantiVAR_017245567D → N in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928871EnsemblClinVar.1
Natural variantiVAR_074537575A → V in OHSS; decreases cell surface expression; no effect on hormone binding; increases levels of internalized hormone receptor complex; cAMP levels are similar to basal levels even at high doses of FSH stimulation indicating reduced signaling. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi330Y → F: No change in intracellular cAMP accumulation. 1 Publication1
Mutagenesisi335Y → F: Reduces intracellular cAMP accumulation. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
2492

MalaCards human disease database

More...
MalaCardsi
FSHR
MIMi233300 phenotype
608115 phenotype

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
243 46,XX gonadal dysgenesis
619 NON RARE IN EUROPE: Primary ovarian failure
64739 Ovarian hyperstimulation syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28386

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2024

Drug and drug target database

More...
DrugBanki
DB00097 Chorionic Gonadotropin (Recombinant)
DB00066 Follitropin beta
DB00032 Menotropins
DB04786 Suramin
DB00094 Urofollitropin

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
253

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FSHR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033420

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001277118 – 695Follicle-stimulating hormone receptorAdd BLAST678

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi18 ↔ 25PROSITE-ProRule annotationCombined sources2 Publications
Disulfide bondi23 ↔ 32PROSITE-ProRule annotationCombined sources2 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi191N-linked (GlcNAc...) asparagineCombined sources2 Publications1
Glycosylationi199N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi275 ↔ 346Combined sources1 Publication
Disulfide bondi276 ↔ 356Combined sources1 Publication
Disulfide bondi276 ↔ 292Combined sources1 Publication
Disulfide bondi292 ↔ 338Combined sources1 Publication
Glycosylationi293N-linked (GlcNAc...) asparagineBy similarity1
Glycosylationi318N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei335Sulfotyrosine1 Publication1
Disulfide bondi442 ↔ 517PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sulfated.1 Publication
N-glycosylated; indirectly required for FSH-binding, possibly via a conformational change that allows high affinity binding of hormone.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Sulfation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P23945

PeptideAtlas

More...
PeptideAtlasi
P23945

PRoteomics IDEntifications database

More...
PRIDEi
P23945

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54168
54169 [P23945-2]
54170 [P23945-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P23945

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P23945

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Sertoli cells and ovarian granulosa cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170820 Expressed in 52 organ(s), highest expression level in lower esophagus muscularis layer

CleanEx database of gene expression profiles

More...
CleanExi
HS_FSHR

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P23945 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P23945 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer. Functions as a homotrimer binding the FSH hormone heterodimer composed of CGA and FSHB (PubMed:24692546). Interacts with ARRB2 (By similarity).By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAQP273484EBI-848239,EBI-359854

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108770, 35 interactors

Database of interacting proteins

More...
DIPi
DIP-35605N

Protein interaction database and analysis system

More...
IntActi
P23945, 2 interactors

Molecular INTeraction database

More...
MINTi
P23945

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000384708

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P23945

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1695
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XUNmodel-A49-228[»]
1XWDX-ray2.92C/F17-268[»]
4AY9X-ray2.50X/Y/Z17-366[»]
4MQWX-ray2.90X/Y/Z16-366[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P23945

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P23945

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P23945

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini18 – 46LRRNTAdd BLAST29
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati49 – 72LRR 1Add BLAST24
Repeati73 – 97LRR 2Add BLAST25
Repeati98 – 118LRR 3Add BLAST21
Repeati119 – 143LRR 4Add BLAST25
Repeati144 – 169LRR 5Add BLAST26
Repeati170 – 192LRR 6Add BLAST23
Repeati193 – 216LRR 7Add BLAST24
Repeati217 – 240LRR 8Add BLAST24
Repeati241 – 259LRR 9Add BLAST19

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2087 Eukaryota
ENOG410XR1T LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000045902

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG003521

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P23945

KEGG Orthology (KO)

More...
KOi
K04247

Database of Orthologous Groups

More...
OrthoDBi
257031at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P23945

TreeFam database of animal gene trees

More...
TreeFami
TF316814

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002272 FSH_rcpt
IPR024635 GnHR_TM
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR002131 Gphrmn_rcpt_fam
IPR026906 LRR_5
IPR000372 LRRNT
IPR034298 TSHR/LHCGR/FSHR

The PANTHER Classification System

More...
PANTHERi
PTHR24372 PTHR24372, 1 hit
PTHR24372:SF5 PTHR24372:SF5, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00001 7tm_1, 1 hit
PF12369 GnHR_trans, 1 hit
PF13306 LRR_5, 2 hits
PF01462 LRRNT, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01143 FSHRECEPTOR
PR00373 GLYCHORMONER
PR00237 GPCRRHODOPSN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00013 LRRNT, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Long (identifier: P23945-1) [UniParc]FASTAAdd to basket
Also known as: R1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALLLVSLLA FLSLGSGCHH RICHCSNRVF LCQESKVTEI PSDLPRNAIE
60 70 80 90 100
LRFVLTKLRV IQKGAFSGFG DLEKIEISQN DVLEVIEADV FSNLPKLHEI
110 120 130 140 150
RIEKANNLLY INPEAFQNLP NLQYLLISNT GIKHLPDVHK IHSLQKVLLD
160 170 180 190 200
IQDNINIHTI ERNSFVGLSF ESVILWLNKN GIQEIHNCAF NGTQLDELNL
210 220 230 240 250
SDNNNLEELP NDVFHGASGP VILDISRTRI HSLPSYGLEN LKKLRARSTY
260 270 280 290 300
NLKKLPTLEK LVALMEASLT YPSHCCAFAN WRRQISELHP ICNKSILRQE
310 320 330 340 350
VDYMTQARGQ RSSLAEDNES SYSRGFDMTY TEFDYDLCNE VVDVTCSPKP
360 370 380 390 400
DAFNPCEDIM GYNILRVLIW FISILAITGN IIVLVILTTS QYKLTVPRFL
410 420 430 440 450
MCNLAFADLC IGIYLLLIAS VDIHTKSQYH NYAIDWQTGA GCDAAGFFTV
460 470 480 490 500
FASELSVYTL TAITLERWHT ITHAMQLDCK VQLRHAASVM VMGWIFAFAA
510 520 530 540 550
ALFPIFGISS YMKVSICLPM DIDSPLSQLY VMSLLVLNVL AFVVICGCYI
560 570 580 590 600
HIYLTVRNPN IVSSSSDTRI AKRMAMLIFT DFLCMAPISF FAISASLKVP
610 620 630 640 650
LITVSKAKIL LVLFHPINSC ANPFLYAIFT KNFRRDFFIL LSKCGCYEMQ
660 670 680 690
AQIYRTETSS TVHNTHPRNG HCSSAPRVTN GSTYILVPLS HLAQN
Length:695
Mass (Da):78,265
Last modified:November 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i766BC421014CD5A4
GO
Isoform Short (identifier: P23945-2) [UniParc]FASTAAdd to basket
Also known as: E9Del

The sequence of this isoform differs from the canonical sequence as follows:
     224-285: Missing.

Show »
Length:633
Mass (Da):71,079
Checksum:iAEB5E6DE7905AD41
GO
Isoform 3 (identifier: P23945-3) [UniParc]FASTAAdd to basket
Also known as: E6Del

The sequence of this isoform differs from the canonical sequence as follows:
     149-174: Missing.

Show »
Length:669
Mass (Da):75,309
Checksum:i13EBEE0CB4E1EEB9
GO
Isoform 4 (identifier: P23945-4) [UniParc]FASTAAdd to basket
Also known as: E8'Inc

The sequence of this isoform differs from the canonical sequence as follows:
     223-223: L → LNRRTRTPTEPNVLLAKYPSGQGVLEEPESLSSSI

Show »
Length:729
Mass (Da):81,974
Checksum:i4C3BE97328EE2E34
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1D5RMN4A0A1D5RMN4_HUMAN
Follicle-stimulating hormone recept...
FSHR
695Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JDA1C9JDA1_HUMAN
Follicle-stimulating hormone recept...
FSHR
278Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBM4F8WBM4_HUMAN
Follicle-stimulating hormone recept...
FSHR
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti13S → R in CAA48179 (PubMed:1359889).Curated1
Sequence conflicti112N → T in AAA52477 (PubMed:1709010).Curated1
Sequence conflicti197 – 198EL → AV in AAA52477 (PubMed:1709010).Curated2
Sequence conflicti295S → P in CAA48179 (PubMed:1359889).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039279128S → Y in OHSS; displays increase in affinity and sensitivity toward hCG and does not show any constitutive activity nor promiscuous activation by TSH. 1 Publication1
Natural variantiVAR_018045160I → T in ODG1; impairs cell surface expression. 1 Publication1
Natural variantiVAR_018046189A → V in ODG1; very frequent in the Finnish population. 2 Publications1
Natural variantiVAR_039280224D → V in ODG1; FSH binding is barely detectable; impaired targeting to the cell membrane; adenylate cyclase stimulation by FSH is 4 +-2% residual activity. 1 Publication1
Natural variantiVAR_013903307A → T9 PublicationsCorresponds to variant dbSNP:rs6165EnsemblClinVar.1
Natural variantiVAR_039281348P → R in ODG1. 1 Publication1
Natural variantiVAR_018047419A → T in ODG1. 1 Publication1
Natural variantiVAR_039282449T → A in OHSS; increase of receptor sensitivity to both hCG and TSH together with an increase in basal activity. 1 Publication1
Natural variantiVAR_017244449T → I in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928870EnsemblClinVar.1
Natural variantiVAR_074535512M → I in OHSS; inhibits activation of PI3K/AKT signaling pathway; reduces cAMP production; no effect on ERK1/2 signaling pathway activation. 1 Publication1
Natural variantiVAR_074536514V → A in OHSS; increases cell surface expression; no effect on hormone binding; increases signaling activity. 1 Publication1
Natural variantiVAR_039283519P → T in ODG1; totally impairs adenylate cyclase stimulation in vitro; alters the cell surface targeting of the receptor which remains trapped intracellularly. 1 Publication1
Natural variantiVAR_013904524S → R1 PublicationCorresponds to variant dbSNP:rs6167Ensembl.1
Natural variantiVAR_039284545I → T in OHSS; displays promiscuous activation by both hCG and TSH together with detectable constitutive activity. 1 Publication1
Natural variantiVAR_039285567D → G Activating mutation resulting in 1.5-fold increase in basal cAMP production compared to the wild-type receptor. 1 Publication1
Natural variantiVAR_017245567D → N in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928871EnsemblClinVar.1
Natural variantiVAR_018048573R → C in ODG1; alters signal transduction of the receptor; adenylate cyclase stimulation by FSH is 24 +-4% residual activity. 2 Publications1
Natural variantiVAR_074537575A → V in OHSS; decreases cell surface expression; no effect on hormone binding; increases levels of internalized hormone receptor complex; cAMP levels are similar to basal levels even at high doses of FSH stimulation indicating reduced signaling. 1 Publication1
Natural variantiVAR_018049591F → S in ovarian sex cord tumor; loss of function. 1 Publication1
Natural variantiVAR_039286601L → V in ODG1; binds FSH with a similar affinity than the wild-type receptor; adenylate cyclase stimulation by FSH is 12 +-3% residual activity. 1 Publication1
Natural variantiVAR_013905680N → S Associated with longer menstrual cycles. 7 PublicationsCorresponds to variant dbSNP:rs6166Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043181149 – 174Missing in isoform 3. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_053411223L → LNRRTRTPTEPNVLLAKYPS GQGVLEEPESLSSSI in isoform 4. Curated1
Alternative sequenceiVSP_001953224 – 285Missing in isoform Short. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M65085 mRNA Translation: AAA52477.1
M95489 mRNA Translation: AAA52478.1
S59900 mRNA Translation: AAB26480.1
JN003607 mRNA Translation: AEI86722.1
AY429104 mRNA Translation: AAR07899.1
AK292562 mRNA Translation: BAF85251.1
AC007189 Genomic DNA No translation available.
AC079394 Genomic DNA No translation available.
AC092533 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00188.1
CH471053 Genomic DNA Translation: EAX00189.1
BC096831 mRNA Translation: AAH96831.1
BC118548 mRNA Translation: AAI18549.1
BC125270 mRNA Translation: AAI25271.1
X68044 mRNA Translation: CAA48179.1
S73199 Genomic DNA Translation: AAB32071.1
S73526 Genomic DNA Translation: AAB32225.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1843.1 [P23945-1]
CCDS1844.2 [P23945-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
I57661 QRHUFT

NCBI Reference Sequences

More...
RefSeqi
NP_000136.2, NM_000145.3
NP_852111.2, NM_181446.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.1428

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304421; ENSP00000306780; ENSG00000170820

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2492

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2492

UCSC genome browser

More...
UCSCi
uc002rww.4 human
uc010fbn.4 human [P23945-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SHMPD

The Singapore human mutation and polymorphism database

Sequence-structure-function-analysis of glycoprotein hormone receptors

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M65085 mRNA Translation: AAA52477.1
M95489 mRNA Translation: AAA52478.1
S59900 mRNA Translation: AAB26480.1
JN003607 mRNA Translation: AEI86722.1
AY429104 mRNA Translation: AAR07899.1
AK292562 mRNA Translation: BAF85251.1
AC007189 Genomic DNA No translation available.
AC079394 Genomic DNA No translation available.
AC092533 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00188.1
CH471053 Genomic DNA Translation: EAX00189.1
BC096831 mRNA Translation: AAH96831.1
BC118548 mRNA Translation: AAI18549.1
BC125270 mRNA Translation: AAI25271.1
X68044 mRNA Translation: CAA48179.1
S73199 Genomic DNA Translation: AAB32071.1
S73526 Genomic DNA Translation: AAB32225.1
CCDSiCCDS1843.1 [P23945-1]
CCDS1844.2 [P23945-3]
PIRiI57661 QRHUFT
RefSeqiNP_000136.2, NM_000145.3
NP_852111.2, NM_181446.2
UniGeneiHs.1428

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XUNmodel-A49-228[»]
1XWDX-ray2.92C/F17-268[»]
4AY9X-ray2.50X/Y/Z17-366[»]
4MQWX-ray2.90X/Y/Z16-366[»]
ProteinModelPortaliP23945
SMRiP23945
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108770, 35 interactors
DIPiDIP-35605N
IntActiP23945, 2 interactors
MINTiP23945
STRINGi9606.ENSP00000384708

Chemistry databases

BindingDBiP23945
ChEMBLiCHEMBL2024
DrugBankiDB00097 Chorionic Gonadotropin (Recombinant)
DB00066 Follitropin beta
DB00032 Menotropins
DB04786 Suramin
DB00094 Urofollitropin
GuidetoPHARMACOLOGYi253

Protein family/group databases

TCDBi9.A.14.1.5 the g-protein-coupled receptor (gpcr) family

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiP23945
PhosphoSitePlusiP23945

Polymorphism and mutation databases

BioMutaiFSHR
DMDMi311033420

Proteomic databases

PaxDbiP23945
PeptideAtlasiP23945
PRIDEiP23945
ProteomicsDBi54168
54169 [P23945-2]
54170 [P23945-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304421; ENSP00000306780; ENSG00000170820
GeneIDi2492
KEGGihsa:2492
UCSCiuc002rww.4 human
uc010fbn.4 human [P23945-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2492
DisGeNETi2492
EuPathDBiHostDB:ENSG00000170820.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FSHR

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0029905
HGNCiHGNC:3969 FSHR
MalaCardsiFSHR
MIMi136435 gene
233300 phenotype
608115 phenotype
neXtProtiNX_P23945
Orphaneti243 46,XX gonadal dysgenesis
619 NON RARE IN EUROPE: Primary ovarian failure
64739 Ovarian hyperstimulation syndrome
PharmGKBiPA28386

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2087 Eukaryota
ENOG410XR1T LUCA
HOGENOMiHOG000045902
HOVERGENiHBG003521
InParanoidiP23945
KOiK04247
OrthoDBi257031at2759
PhylomeDBiP23945
TreeFamiTF316814

Enzyme and pathway databases

ReactomeiR-HSA-375281 Hormone ligand-binding receptors
R-HSA-418555 G alpha (s) signalling events
SignaLinkiP23945
SIGNORiP23945

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FSHR human
EvolutionaryTraceiP23945

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Follicle-stimulating_hormone_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2492

Protein Ontology

More...
PROi
PR:P23945

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000170820 Expressed in 52 organ(s), highest expression level in lower esophagus muscularis layer
CleanExiHS_FSHR
ExpressionAtlasiP23945 baseline and differential
GenevisibleiP23945 HS

Family and domain databases

InterProiView protein in InterPro
IPR002272 FSH_rcpt
IPR024635 GnHR_TM
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR002131 Gphrmn_rcpt_fam
IPR026906 LRR_5
IPR000372 LRRNT
IPR034298 TSHR/LHCGR/FSHR
PANTHERiPTHR24372 PTHR24372, 1 hit
PTHR24372:SF5 PTHR24372:SF5, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PF12369 GnHR_trans, 1 hit
PF13306 LRR_5, 2 hits
PF01462 LRRNT, 1 hit
PRINTSiPR01143 FSHRECEPTOR
PR00373 GLYCHORMONER
PR00237 GPCRRHODOPSN
SMARTiView protein in SMART
SM00013 LRRNT, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFSHR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P23945
Secondary accession number(s): A0A0A0MSC5
, A8K947, G5CBS7, G5E967, J3KQ00, Q05AH0, Q16225, Q4QRJ3, Q4ZFZ2, Q53RW2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: November 2, 2010
Last modified: January 16, 2019
This is version 210 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  7. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again