Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Follicle-stimulating hormone receptor

Gene

FSHR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

G protein-coupled receptor for follitropin, the follicle-stimulating hormone (PubMed:11847099, PubMed:24058690, PubMed:24692546). Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways (PubMed:24058690).3 Publications

GO - Molecular functioni

  • follicle-stimulating hormone receptor activity Source: UniProtKB
  • G protein-coupled peptide receptor activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-375281 Hormone ligand-binding receptors
R-HSA-418555 G alpha (s) signalling events
SignaLinkiP23945
SIGNORiP23945

Protein family/group databases

TCDBi9.A.14.1.5 the g-protein-coupled receptor (gpcr) family

Names & Taxonomyi

Protein namesi
Recommended name:
Follicle-stimulating hormone receptor
Short name:
FSH-R
Alternative name(s):
Follitropin receptor
Gene namesi
Name:FSHR
Synonyms:LGR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000170820.11
HGNCiHGNC:3969 FSHR
MIMi136435 gene
neXtProtiNX_P23945

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini18 – 366ExtracellularSequence analysisAdd BLAST349
Transmembranei367 – 387Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini388 – 398CytoplasmicSequence analysisAdd BLAST11
Transmembranei399 – 421Helical; Name=2Sequence analysisAdd BLAST23
Topological domaini422 – 443ExtracellularSequence analysisAdd BLAST22
Transmembranei444 – 465Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini466 – 485CytoplasmicSequence analysisAdd BLAST20
Transmembranei486 – 508Helical; Name=4Sequence analysisAdd BLAST23
Topological domaini509 – 528ExtracellularSequence analysisAdd BLAST20
Transmembranei529 – 550Helical; Name=5Sequence analysisAdd BLAST22
Topological domaini551 – 573CytoplasmicSequence analysisAdd BLAST23
Transmembranei574 – 597Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini598 – 608ExtracellularSequence analysisAdd BLAST11
Transmembranei609 – 630Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini631 – 695CytoplasmicSequence analysisAdd BLAST65

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Ovarian dysgenesis 1 (ODG1)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disease characterized by primary amenorrhea, variable development of secondary sex characteristics, poorly developed streak ovaries, and high serum levels of follicle-stimulating hormone (FSH) and luteinizing hormone (LH).
See also OMIM:233300
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018045160I → T in ODG1; impairs cell surface expression. 1 Publication1
Natural variantiVAR_018046189A → V in ODG1; very frequent in the Finnish population. 2 Publications1
Natural variantiVAR_039280224D → V in ODG1; FSH binding is barely detectable; impaired targeting to the cell membrane; adenylate cyclase stimulation by FSH is 4 +-2% residual activity. 1 Publication1
Natural variantiVAR_039281348P → R in ODG1. 1 Publication1
Natural variantiVAR_018047419A → T in ODG1. 1 Publication1
Natural variantiVAR_039283519P → T in ODG1; totally impairs adenylate cyclase stimulation in vitro; alters the cell surface targeting of the receptor which remains trapped intracellularly. 1 Publication1
Natural variantiVAR_018048573R → C in ODG1; alters signal transduction of the receptor; adenylate cyclase stimulation by FSH is 24 +-4% residual activity. 2 Publications1
Natural variantiVAR_039286601L → V in ODG1; binds FSH with a similar affinity than the wild-type receptor; adenylate cyclase stimulation by FSH is 12 +-3% residual activity. 1 Publication1
Ovarian hyperstimulation syndrome (OHSS)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionDisorder which occurs either spontaneously or most often as an iatrogenic complication of ovarian stimulation treatments for in vitro fertilization. The clinical manifestations vary from abdominal distention and discomfort to potentially life-threatening, massive ovarian enlargement and capillary leak with fluid sequestration. Pathologic features of this syndrome include the presence of multiple serous and hemorrhagic follicular cysts lined by luteinized cells, a condition called hyperreactio luteinalis.
See also OMIM:608115
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039279128S → Y in OHSS; displays increase in affinity and sensitivity toward hCG and does not show any constitutive activity nor promiscuous activation by TSH. 1 Publication1
Natural variantiVAR_039282449T → A in OHSS; increase of receptor sensitivity to both hCG and TSH together with an increase in basal activity. 1 Publication1
Natural variantiVAR_017244449T → I in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928870EnsemblClinVar.1
Natural variantiVAR_074535512M → I in OHSS; inhibits activation of PI3K/AKT signaling pathway; reduces cAMP production; no effect on ERK1/2 signaling pathway activation. 1 Publication1
Natural variantiVAR_074536514V → A in OHSS; increases cell surface expression; no effect on hormone binding; increases signaling activity. 1 Publication1
Natural variantiVAR_039284545I → T in OHSS; displays promiscuous activation by both hCG and TSH together with detectable constitutive activity. 1 Publication1
Natural variantiVAR_017245567D → N in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928871EnsemblClinVar.1
Natural variantiVAR_074537575A → V in OHSS; decreases cell surface expression; no effect on hormone binding; increases levels of internalized hormone receptor complex; cAMP levels are similar to basal levels even at high doses of FSH stimulation indicating reduced signaling. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi330Y → F: No change in intracellular cAMP accumulation. 1 Publication1
Mutagenesisi335Y → F: Reduces intracellular cAMP accumulation. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi2492
MalaCardsiFSHR
MIMi233300 phenotype
608115 phenotype
Orphaneti243 46,XX gonadal dysgenesis
619 NON RARE IN EUROPE: Primary ovarian failure
64739 Ovarian hyperstimulation syndrome
PharmGKBiPA28386

Chemistry databases

ChEMBLiCHEMBL2024
DrugBankiDB00097 Chorionic Gonadotropin (Recombinant)
DB00066 Follitropin beta
DB00032 Menotropins
DB04786 Suramin
DB00094 Urofollitropin
GuidetoPHARMACOLOGYi253

Polymorphism and mutation databases

BioMutaiFSHR
DMDMi311033420

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 17Sequence analysisAdd BLAST17
ChainiPRO_000001277118 – 695Follicle-stimulating hormone receptorAdd BLAST678

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi18 ↔ 25PROSITE-ProRule annotationCombined sources2 Publications
Disulfide bondi23 ↔ 32PROSITE-ProRule annotationCombined sources2 Publications
Glycosylationi191N-linked (GlcNAc...) asparagineCombined sources2 Publications1
Glycosylationi199N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi275 ↔ 346Combined sources1 Publication
Disulfide bondi276 ↔ 356Combined sources1 Publication
Disulfide bondi276 ↔ 292Combined sources1 Publication
Disulfide bondi292 ↔ 338Combined sources1 Publication
Glycosylationi293N-linked (GlcNAc...) asparagineBy similarity1
Glycosylationi318N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei335Sulfotyrosine1 Publication1
Disulfide bondi442 ↔ 517PROSITE-ProRule annotation

Post-translational modificationi

Sulfated.1 Publication
N-glycosylated; indirectly required for FSH-binding, possibly via a conformational change that allows high affinity binding of hormone.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Sulfation

Proteomic databases

PaxDbiP23945
PeptideAtlasiP23945
PRIDEiP23945
ProteomicsDBi54168
54169 [P23945-2]
54170 [P23945-3]

PTM databases

iPTMnetiP23945
PhosphoSitePlusiP23945

Expressioni

Tissue specificityi

Sertoli cells and ovarian granulosa cells.

Gene expression databases

BgeeiENSG00000170820 Expressed in 52 organ(s), highest expression level in lower esophagus muscularis layer
CleanExiHS_FSHR
ExpressionAtlasiP23945 baseline and differential
GenevisibleiP23945 HS

Interactioni

Subunit structurei

Homotrimer. Functions as a homotrimer binding the FSH hormone heterodimer composed of CGA and FSHB (PubMed:24692546). Interacts with ARRB2 (By similarity).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAQP273484EBI-848239,EBI-359854

Protein-protein interaction databases

BioGridi108770, 35 interactors
DIPiDIP-35605N
IntActiP23945, 2 interactors
MINTiP23945
STRINGi9606.ENSP00000384708

Chemistry databases

BindingDBiP23945

Structurei

Secondary structure

1695
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP23945
SMRiP23945
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP23945

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 46LRRNTAdd BLAST29
Repeati49 – 72LRR 1Add BLAST24
Repeati73 – 97LRR 2Add BLAST25
Repeati98 – 118LRR 3Add BLAST21
Repeati119 – 143LRR 4Add BLAST25
Repeati144 – 169LRR 5Add BLAST26
Repeati170 – 192LRR 6Add BLAST23
Repeati193 – 216LRR 7Add BLAST24
Repeati217 – 240LRR 8Add BLAST24
Repeati241 – 259LRR 9Add BLAST19

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2087 Eukaryota
ENOG410XR1T LUCA
HOGENOMiHOG000045902
HOVERGENiHBG003521
InParanoidiP23945
KOiK04247
OrthoDBiEOG091G02BV
PhylomeDBiP23945
TreeFamiTF316814

Family and domain databases

InterProiView protein in InterPro
IPR002272 FSH_rcpt
IPR024635 GnHR_TM
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR002131 Gphrmn_rcpt_fam
IPR026906 LRR_5
IPR000372 LRRNT
IPR034298 TSHR/LHCGR/FSHR
PANTHERiPTHR24372 PTHR24372, 1 hit
PTHR24372:SF5 PTHR24372:SF5, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PF12369 GnHR_trans, 1 hit
PF13306 LRR_5, 2 hits
PF01462 LRRNT, 1 hit
PRINTSiPR01143 FSHRECEPTOR
PR00373 GLYCHORMONER
PR00237 GPCRRHODOPSN
SMARTiView protein in SMART
SM00013 LRRNT, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Long (identifier: P23945-1) [UniParc]FASTAAdd to basket
Also known as: R1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALLLVSLLA FLSLGSGCHH RICHCSNRVF LCQESKVTEI PSDLPRNAIE
60 70 80 90 100
LRFVLTKLRV IQKGAFSGFG DLEKIEISQN DVLEVIEADV FSNLPKLHEI
110 120 130 140 150
RIEKANNLLY INPEAFQNLP NLQYLLISNT GIKHLPDVHK IHSLQKVLLD
160 170 180 190 200
IQDNINIHTI ERNSFVGLSF ESVILWLNKN GIQEIHNCAF NGTQLDELNL
210 220 230 240 250
SDNNNLEELP NDVFHGASGP VILDISRTRI HSLPSYGLEN LKKLRARSTY
260 270 280 290 300
NLKKLPTLEK LVALMEASLT YPSHCCAFAN WRRQISELHP ICNKSILRQE
310 320 330 340 350
VDYMTQARGQ RSSLAEDNES SYSRGFDMTY TEFDYDLCNE VVDVTCSPKP
360 370 380 390 400
DAFNPCEDIM GYNILRVLIW FISILAITGN IIVLVILTTS QYKLTVPRFL
410 420 430 440 450
MCNLAFADLC IGIYLLLIAS VDIHTKSQYH NYAIDWQTGA GCDAAGFFTV
460 470 480 490 500
FASELSVYTL TAITLERWHT ITHAMQLDCK VQLRHAASVM VMGWIFAFAA
510 520 530 540 550
ALFPIFGISS YMKVSICLPM DIDSPLSQLY VMSLLVLNVL AFVVICGCYI
560 570 580 590 600
HIYLTVRNPN IVSSSSDTRI AKRMAMLIFT DFLCMAPISF FAISASLKVP
610 620 630 640 650
LITVSKAKIL LVLFHPINSC ANPFLYAIFT KNFRRDFFIL LSKCGCYEMQ
660 670 680 690
AQIYRTETSS TVHNTHPRNG HCSSAPRVTN GSTYILVPLS HLAQN
Length:695
Mass (Da):78,265
Last modified:November 2, 2010 - v3
Checksum:i766BC421014CD5A4
GO
Isoform Short (identifier: P23945-2) [UniParc]FASTAAdd to basket
Also known as: E9Del

The sequence of this isoform differs from the canonical sequence as follows:
     224-285: Missing.

Show »
Length:633
Mass (Da):71,079
Checksum:iAEB5E6DE7905AD41
GO
Isoform 3 (identifier: P23945-3) [UniParc]FASTAAdd to basket
Also known as: E6Del

The sequence of this isoform differs from the canonical sequence as follows:
     149-174: Missing.

Show »
Length:669
Mass (Da):75,309
Checksum:i13EBEE0CB4E1EEB9
GO
Isoform 4 (identifier: P23945-4) [UniParc]FASTAAdd to basket
Also known as: E8'Inc

The sequence of this isoform differs from the canonical sequence as follows:
     223-223: L → LNRRTRTPTEPNVLLAKYPSGQGVLEEPESLSSSI

Show »
Length:729
Mass (Da):81,974
Checksum:i4C3BE97328EE2E34
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1D5RMN4A0A1D5RMN4_HUMAN
Follicle-stimulating hormone recept...
FSHR
695Annotation score:
C9JDA1C9JDA1_HUMAN
Follicle-stimulating hormone recept...
FSHR
278Annotation score:
F8WBM4F8WBM4_HUMAN
Follicle-stimulating hormone recept...
FSHR
152Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti13S → R in CAA48179 (PubMed:1359889).Curated1
Sequence conflicti112N → T in AAA52477 (PubMed:1709010).Curated1
Sequence conflicti197 – 198EL → AV in AAA52477 (PubMed:1709010).Curated2
Sequence conflicti295S → P in CAA48179 (PubMed:1359889).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039279128S → Y in OHSS; displays increase in affinity and sensitivity toward hCG and does not show any constitutive activity nor promiscuous activation by TSH. 1 Publication1
Natural variantiVAR_018045160I → T in ODG1; impairs cell surface expression. 1 Publication1
Natural variantiVAR_018046189A → V in ODG1; very frequent in the Finnish population. 2 Publications1
Natural variantiVAR_039280224D → V in ODG1; FSH binding is barely detectable; impaired targeting to the cell membrane; adenylate cyclase stimulation by FSH is 4 +-2% residual activity. 1 Publication1
Natural variantiVAR_013903307A → T9 PublicationsCorresponds to variant dbSNP:rs6165EnsemblClinVar.1
Natural variantiVAR_039281348P → R in ODG1. 1 Publication1
Natural variantiVAR_018047419A → T in ODG1. 1 Publication1
Natural variantiVAR_039282449T → A in OHSS; increase of receptor sensitivity to both hCG and TSH together with an increase in basal activity. 1 Publication1
Natural variantiVAR_017244449T → I in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928870EnsemblClinVar.1
Natural variantiVAR_074535512M → I in OHSS; inhibits activation of PI3K/AKT signaling pathway; reduces cAMP production; no effect on ERK1/2 signaling pathway activation. 1 Publication1
Natural variantiVAR_074536514V → A in OHSS; increases cell surface expression; no effect on hormone binding; increases signaling activity. 1 Publication1
Natural variantiVAR_039283519P → T in ODG1; totally impairs adenylate cyclase stimulation in vitro; alters the cell surface targeting of the receptor which remains trapped intracellularly. 1 Publication1
Natural variantiVAR_013904524S → R1 PublicationCorresponds to variant dbSNP:rs6167Ensembl.1
Natural variantiVAR_039284545I → T in OHSS; displays promiscuous activation by both hCG and TSH together with detectable constitutive activity. 1 Publication1
Natural variantiVAR_039285567D → G Activating mutation resulting in 1.5-fold increase in basal cAMP production compared to the wild-type receptor. 1 Publication1
Natural variantiVAR_017245567D → N in OHSS. 1 PublicationCorresponds to variant dbSNP:rs28928871EnsemblClinVar.1
Natural variantiVAR_018048573R → C in ODG1; alters signal transduction of the receptor; adenylate cyclase stimulation by FSH is 24 +-4% residual activity. 2 Publications1
Natural variantiVAR_074537575A → V in OHSS; decreases cell surface expression; no effect on hormone binding; increases levels of internalized hormone receptor complex; cAMP levels are similar to basal levels even at high doses of FSH stimulation indicating reduced signaling. 1 Publication1
Natural variantiVAR_018049591F → S in ovarian sex cord tumor; loss of function. 1 Publication1
Natural variantiVAR_039286601L → V in ODG1; binds FSH with a similar affinity than the wild-type receptor; adenylate cyclase stimulation by FSH is 12 +-3% residual activity. 1 Publication1
Natural variantiVAR_013905680N → S Associated with longer menstrual cycles. 7 PublicationsCorresponds to variant dbSNP:rs6166Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043181149 – 174Missing in isoform 3. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_053411223L → LNRRTRTPTEPNVLLAKYPS GQGVLEEPESLSSSI in isoform 4. Curated1
Alternative sequenceiVSP_001953224 – 285Missing in isoform Short. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M65085 mRNA Translation: AAA52477.1
M95489 mRNA Translation: AAA52478.1
S59900 mRNA Translation: AAB26480.1
JN003607 mRNA Translation: AEI86722.1
AY429104 mRNA Translation: AAR07899.1
AK292562 mRNA Translation: BAF85251.1
AC007189 Genomic DNA No translation available.
AC079394 Genomic DNA No translation available.
AC092533 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00188.1
CH471053 Genomic DNA Translation: EAX00189.1
BC096831 mRNA Translation: AAH96831.1
BC118548 mRNA Translation: AAI18549.1
BC125270 mRNA Translation: AAI25271.1
X68044 mRNA Translation: CAA48179.1
S73199 Genomic DNA Translation: AAB32071.1
S73526 Genomic DNA Translation: AAB32225.1
CCDSiCCDS1843.1 [P23945-1]
CCDS1844.2 [P23945-3]
PIRiI57661 QRHUFT
RefSeqiNP_000136.2, NM_000145.3
NP_852111.2, NM_181446.2
UniGeneiHs.1428

Genome annotation databases

EnsembliENST00000304421; ENSP00000306780; ENSG00000170820
GeneIDi2492
KEGGihsa:2492
UCSCiuc002rww.4 human
uc010fbn.4 human [P23945-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

SHMPD

The Singapore human mutation and polymorphism database

Sequence-structure-function-analysis of glycoprotein hormone receptors

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M65085 mRNA Translation: AAA52477.1
M95489 mRNA Translation: AAA52478.1
S59900 mRNA Translation: AAB26480.1
JN003607 mRNA Translation: AEI86722.1
AY429104 mRNA Translation: AAR07899.1
AK292562 mRNA Translation: BAF85251.1
AC007189 Genomic DNA No translation available.
AC079394 Genomic DNA No translation available.
AC092533 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00188.1
CH471053 Genomic DNA Translation: EAX00189.1
BC096831 mRNA Translation: AAH96831.1
BC118548 mRNA Translation: AAI18549.1
BC125270 mRNA Translation: AAI25271.1
X68044 mRNA Translation: CAA48179.1
S73199 Genomic DNA Translation: AAB32071.1
S73526 Genomic DNA Translation: AAB32225.1
CCDSiCCDS1843.1 [P23945-1]
CCDS1844.2 [P23945-3]
PIRiI57661 QRHUFT
RefSeqiNP_000136.2, NM_000145.3
NP_852111.2, NM_181446.2
UniGeneiHs.1428

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XUNmodel-A49-228[»]
1XWDX-ray2.92C/F17-268[»]
4AY9X-ray2.50X/Y/Z17-366[»]
4MQWX-ray2.90X/Y/Z16-366[»]
ProteinModelPortaliP23945
SMRiP23945
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108770, 35 interactors
DIPiDIP-35605N
IntActiP23945, 2 interactors
MINTiP23945
STRINGi9606.ENSP00000384708

Chemistry databases

BindingDBiP23945
ChEMBLiCHEMBL2024
DrugBankiDB00097 Chorionic Gonadotropin (Recombinant)
DB00066 Follitropin beta
DB00032 Menotropins
DB04786 Suramin
DB00094 Urofollitropin
GuidetoPHARMACOLOGYi253

Protein family/group databases

TCDBi9.A.14.1.5 the g-protein-coupled receptor (gpcr) family
GPCRDBiSearch...

PTM databases

iPTMnetiP23945
PhosphoSitePlusiP23945

Polymorphism and mutation databases

BioMutaiFSHR
DMDMi311033420

Proteomic databases

PaxDbiP23945
PeptideAtlasiP23945
PRIDEiP23945
ProteomicsDBi54168
54169 [P23945-2]
54170 [P23945-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304421; ENSP00000306780; ENSG00000170820
GeneIDi2492
KEGGihsa:2492
UCSCiuc002rww.4 human
uc010fbn.4 human [P23945-1]

Organism-specific databases

CTDi2492
DisGeNETi2492
EuPathDBiHostDB:ENSG00000170820.11
GeneCardsiFSHR
H-InvDBiHIX0029905
HGNCiHGNC:3969 FSHR
MalaCardsiFSHR
MIMi136435 gene
233300 phenotype
608115 phenotype
neXtProtiNX_P23945
Orphaneti243 46,XX gonadal dysgenesis
619 NON RARE IN EUROPE: Primary ovarian failure
64739 Ovarian hyperstimulation syndrome
PharmGKBiPA28386
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2087 Eukaryota
ENOG410XR1T LUCA
HOGENOMiHOG000045902
HOVERGENiHBG003521
InParanoidiP23945
KOiK04247
OrthoDBiEOG091G02BV
PhylomeDBiP23945
TreeFamiTF316814

Enzyme and pathway databases

ReactomeiR-HSA-375281 Hormone ligand-binding receptors
R-HSA-418555 G alpha (s) signalling events
SignaLinkiP23945
SIGNORiP23945

Miscellaneous databases

ChiTaRSiFSHR human
EvolutionaryTraceiP23945
GeneWikiiFollicle-stimulating_hormone_receptor
GenomeRNAii2492
PROiPR:P23945
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170820 Expressed in 52 organ(s), highest expression level in lower esophagus muscularis layer
CleanExiHS_FSHR
ExpressionAtlasiP23945 baseline and differential
GenevisibleiP23945 HS

Family and domain databases

InterProiView protein in InterPro
IPR002272 FSH_rcpt
IPR024635 GnHR_TM
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR002131 Gphrmn_rcpt_fam
IPR026906 LRR_5
IPR000372 LRRNT
IPR034298 TSHR/LHCGR/FSHR
PANTHERiPTHR24372 PTHR24372, 1 hit
PTHR24372:SF5 PTHR24372:SF5, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PF12369 GnHR_trans, 1 hit
PF13306 LRR_5, 2 hits
PF01462 LRRNT, 1 hit
PRINTSiPR01143 FSHRECEPTOR
PR00373 GLYCHORMONER
PR00237 GPCRRHODOPSN
SMARTiView protein in SMART
SM00013 LRRNT, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFSHR_HUMAN
AccessioniPrimary (citable) accession number: P23945
Secondary accession number(s): A0A0A0MSC5
, A8K947, G5CBS7, G5E967, J3KQ00, Q05AH0, Q16225, Q4QRJ3, Q4ZFZ2, Q53RW2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: November 2, 2010
Last modified: November 7, 2018
This is version 208 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again