Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (18 Sep 2019)
Sequence version 4 (24 Jul 2013)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Kinesin-like protein unc-104

Gene

unc-104

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Motor protein involved in microtubule-associated anterograde transport (PubMed:1846075). Regulates the transport of synaptic vesicle precursors in the axon of DA motor neurons (PubMed:20510931). Essential for the transport of synaptic components during the synaptic remodeling of the DD motor neuron, probably downstream of cdk-5 and/or pct-1/cyy-1 complex (PubMed:21609829). Required for the anterograde transport of neuropeptide-containing dense core vesicles along axons (PubMed:12657671). Involved in necrotic cell death (PubMed:22157748).5 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi93 – 100ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
Biological processCell cycle, Cell division, Necrosis, Neurogenesis, Transport
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-CEL-983189 Kinesins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein unc-104
Alternative name(s):
Uncoordinated protein 104
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:unc-104
ORF Names:C52E12.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome II

Organism-specific databases

WormBase

More...
WormBasei
C52E12.2a ; CE48050 ; WBGene00006831 ; unc-104
C52E12.2b ; CE47855 ; WBGene00006831 ; unc-104

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Worms exhibit uncoordinated and slow movement.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1497D → N in e1265; increased survival in response to hypoxia induced by sodium azide. Abnormal accumulation of egl-21, egl-3, FMRFamide-like peptides (FaRPs) and snb-1 in neuronal cell bodies. Reduced number of neuron cell corpses in a hyperactive mec-4 or deg-3 mutant background. 2 Publications1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254131 – 1584Kinesin-like protein unc-104Add BLAST1584

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P23678

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P23678

PeptideAtlas

More...
PeptideAtlasi
P23678

PRoteomics IDEntifications database

More...
PRIDEi
P23678

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P23678

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00006831 Expressed in 4 organ(s), highest expression level in multi-cellular organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
syd-2Q210499EBI-15812209,EBI-327903

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
39482, 2 interactors

Database of interacting proteins

More...
DIPi
DIP-49010N

Protein interaction database and analysis system

More...
IntActi
P23678, 1 interactor

STRING: functional protein association networks

More...
STRINGi
6239.C52E12.2b

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P23678

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3 – 347Kinesin motorPROSITE-ProRule annotationAdd BLAST345
Domaini1460 – 1558PHPROSITE-ProRule annotationAdd BLAST99

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni183 – 335Microtubule-bindingAdd BLAST153

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili425 – 445Sequence analysisAdd BLAST21
Coiled coili598 – 652Sequence analysisAdd BLAST55
Coiled coili777 – 797Sequence analysisAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi957 – 1052Arg/Lys-rich (basic)Add BLAST96
Compositional biasi1203 – 1584Arg/Lys-rich (basic)Add BLAST382

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0245 Eukaryota
COG5059 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000168546

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000165968

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P23678

KEGG Orthology (KO)

More...
KOi
K10392

Identification of Orthologs from Complete Genome Data

More...
OMAi
LHQEDEF

Database of Orthologous Groups

More...
OrthoDBi
76316at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060 FHA, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115 PTHR24115, 3 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473 DUF3694, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 2 hits
PF00169 PH, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380 KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: P23678-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSVKVAVRV RPFNQREISN TSKCVLQVNG NTTTINGHSI NKENFSFNFD
60 70 80 90 100
HSYWSFARND PHFITQKQVY EELGVEMLEH AFEGYNVCIF AYGQTGSGKS
110 120 130 140 150
YTMMGKANDP DEMGIIPRLC NDLFARIDNN NDKDVQYSVE VSYMEIYCER
160 170 180 190 200
VKDLLNPNSG GNLRVREHPL LGPYVDDLTK MAVCSYHDIC NLMDEGNKAR
210 220 230 240 250
TVAATNMNST SSRSHAVFTI VLTQKRHCAD SNLDTEKHSK ISLVDLAGSE
260 270 280 290 300
RANSTGAEGQ RLKEGANINK SLTTLGLVIS KLAEESTKKK KSNKGVIPYR
310 320 330 340 350
DSVLTWLLRE NLGGNSKTAM LAALSPADIN FDETLSTLRY ADRAKQIVCQ
360 370 380 390 400
AVVNEDPNAK LIRELNEEVI KLRHILKDKG IDVTDVQETP GKHKKGPKLP
410 420 430 440 450
AHVHEQLEKL QESEKLMAEI GKTWEQKLIH TEEIRKQREE ELRDMGLACA
460 470 480 490 500
EDGTTLGVFS PKKLPHLVNL NEDPLMSECL IYYLKEGVTS VGRPEAEHRP
510 520 530 540 550
DILLSGEAIL ELHCEFINED GNVTLTMKPN ASCYINGKQV TTPTVLHTGS
560 570 580 590 600
RVILGEHHVF RYNDPQEARQ SRHNLAAIAE QPIDWKYAQQ ELLDKQGIDL
610 620 630 640 650
KADMEKKMLE MESQYRREKV ELEQKMYHQT REYESMIENL QKQVDLAQSY
660 670 680 690 700
ISGGGSIWEG ERMLTSSLLE FPEELKWTSD QKRVVLKAAI KWRYHQFTSV
710 720 730 740 750
RDDLWGNAIF VKEANAISVE LKKKVQFQFA LLTDTMYSPL PPDLLPPGED
760 770 780 790 800
LTLRPYPKTV VAIQVQDLKN GATHYWSIEK LKQRLEAMRD MYETDAEMSP
810 820 830 840 850
ADGDPMMDAL MGTDPFYDRF PWFRMVGRAF VYLNNLLHNV PLIHKVAVVN
860 870 880 890 900
EKGEVKGYLK VAIEPVQKDE VINQKKGVRQ TAKLHFRKED FLKSHKNGET
910 920 930 940 950
SDSDALAFPE HMQEEVEFCF RVVVLQAIDV ADTYSDVFCQ FNFLHRHDEA
960 970 980 990 1000
FSTEPMKNSK SPLTFEHTQN LHIKMSKTFL HYLHHFPIIF EVFGHFQPKS
1010 1020 1030 1040 1050
EQFNFERQNS ALGRRLSTKL TFQQPSLVIS TPVKSKKANA PIQNNNASVK
1060 1070 1080 1090 1100
SKHDLLVWFE ICELANNGEY VPTIVDHAQG LPTHGIFLLH QGIQRRIKIT
1110 1120 1130 1140 1150
ICHEKGELKW KDCQELVVGR IRAGPEWAGG DDVDVLSLGL FPGTFMEFSM
1160 1170 1180 1190 1200
DDRTFFQFEA AWDSSLHNSP LLNRVSNYGD QIYMTLSAYM ELDGCAQPAV
1210 1220 1230 1240 1250
VTKDLCLLIY ARDSKISAAS RFCRSLVGGI SKSPEMNRVP GVYQLCLKDG
1260 1270 1280 1290 1300
SDSGSPGAIR RQRRVLDTSS AYVRGEENLG QWRPRGDSLI FEHQWELEKL
1310 1320 1330 1340 1350
TRLQQVERVR LFLRLRDRLK GKKNKGEART PVSPCDPVCA IPESIKLDEK
1360 1370 1380 1390 1400
DKGIVGKVLG LIRRKIPMNK DPPTGNKAQE LSDESGSNSI TSPVSDKSLI
1410 1420 1430 1440 1450
KSSRSSDLLC RQKSKSDQNL ASNDDIVDNL GGMKRSLSGS RILQLNILVP
1460 1470 1480 1490 1500
EVLEERVGVV VSKKGYMNFL EEKTQGWTRR WVIVRRPYIL LFRDDRDLVI
1510 1520 1530 1540 1550
RGIINLANAR IEHSEDQQAM VKVPNTFSVC TNQRGFLMQM MPGDEMYDWL
1560 1570 1580
YAINPLMAGQ MKLHGNQNGT TLKSPTSSSS IAAS
Length:1,584
Mass (Da):179,652
Last modified:July 24, 2013 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD558DD367545544B
GO
Isoform b (identifier: P23678-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     786-786: E → EDMRIFYNSELSVAGTPVDVPYPPVAEGWLAALNRNSARLIPDRQRLE
     1255-1257: Missing.

Note: No experimental confirmation available.
Show »
Length:1,628
Mass (Da):184,692
Checksum:i50715D9E8C3DDD4D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti905A → R in AAA03517 (PubMed:1846075).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti598I → T. 1
Natural varianti930V → M. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011760786E → EDMRIFYNSELSVAGTPVDV PYPPVAEGWLAALNRNSARL IPDRQRLE in isoform b. Curated1
Alternative sequenceiVSP_0117611255 – 1257Missing in isoform b. Curated3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M58582 mRNA Translation: AAA03517.1
FO080554 Genomic DNA Translation: CCD64622.2
FO080554 Genomic DNA Translation: CCD64623.2

Protein sequence database of the Protein Information Resource

More...
PIRi
JN0114

NCBI Reference Sequences

More...
RefSeqi
NP_001022041.2, NM_001026870.5 [P23678-2]
NP_741019.3, NM_171017.8 [P23678-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
C52E12.2a.1; C52E12.2a.1; WBGene00006831 [P23678-1]
C52E12.2a.2; C52E12.2a.2; WBGene00006831 [P23678-1]
C52E12.2b.1; C52E12.2b.1; WBGene00006831 [P23678-2]
C52E12.2b.2; C52E12.2b.2; WBGene00006831 [P23678-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
174144

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_C52E12.2

UCSC genome browser

More...
UCSCi
C52E12.2a c. elegans [P23678-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58582 mRNA Translation: AAA03517.1
FO080554 Genomic DNA Translation: CCD64622.2
FO080554 Genomic DNA Translation: CCD64623.2
PIRiJN0114
RefSeqiNP_001022041.2, NM_001026870.5 [P23678-2]
NP_741019.3, NM_171017.8 [P23678-1]

3D structure databases

SMRiP23678
ModBaseiSearch...

Protein-protein interaction databases

BioGridi39482, 2 interactors
DIPiDIP-49010N
IntActiP23678, 1 interactor
STRINGi6239.C52E12.2b

PTM databases

iPTMnetiP23678

Proteomic databases

EPDiP23678
PaxDbiP23678
PeptideAtlasiP23678
PRIDEiP23678

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC52E12.2a.1; C52E12.2a.1; WBGene00006831 [P23678-1]
C52E12.2a.2; C52E12.2a.2; WBGene00006831 [P23678-1]
C52E12.2b.1; C52E12.2b.1; WBGene00006831 [P23678-2]
C52E12.2b.2; C52E12.2b.2; WBGene00006831 [P23678-2]
GeneIDi174144
KEGGicel:CELE_C52E12.2
UCSCiC52E12.2a c. elegans [P23678-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
36876
WormBaseiC52E12.2a ; CE48050 ; WBGene00006831 ; unc-104
C52E12.2b ; CE47855 ; WBGene00006831 ; unc-104

Phylogenomic databases

eggNOGiKOG0245 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00940000168546
HOGENOMiHOG000165968
InParanoidiP23678
KOiK10392
OMAiLHQEDEF
OrthoDBi76316at2759

Enzyme and pathway databases

ReactomeiR-CEL-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-CEL-983189 Kinesins

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P23678

Gene expression databases

BgeeiWBGene00006831 Expressed in 4 organ(s), highest expression level in multi-cellular organism

Family and domain databases

CDDicd00060 FHA, 1 hit
Gene3Di2.30.29.30, 1 hit
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR24115 PTHR24115, 3 hits
PfamiView protein in Pfam
PF12473 DUF3694, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 2 hits
PF00169 PH, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUN104_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P23678
Secondary accession number(s): Q8MQ97, Q8MQ98
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: July 24, 2013
Last modified: September 18, 2019
This is version 161 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again