Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plasma membrane calcium-transporting ATPase 4

Gene

ATP2B4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Calcium/calmodulin-regulated and magnesium-dependent enzyme that catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell (PubMed:8530416). By regulating sperm cell calcium homeostasis, may play a role in sperm motility (By similarity).By similarity1 Publication

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).1 Publication

Activity regulationi

Activated by calcium/calmodulin.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei4654-aspartylphosphate intermediateBy similarity1
Metal bindingi785MagnesiumBy similarity1
Metal bindingi789MagnesiumBy similarity1

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • calcium-transporting ATPase activity Source: BHF-UCL
  • calmodulin binding Source: BHF-UCL
  • metal ion binding Source: UniProtKB-KW
  • nitric-oxide synthase binding Source: BHF-UCL
  • nitric-oxide synthase inhibitor activity Source: BHF-UCL
  • PDZ domain binding Source: GO_Central
  • protein kinase binding Source: Ensembl
  • protein phosphatase 2B binding Source: BHF-UCL
  • scaffold protein binding Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionCalmodulin-binding, Hydrolase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-418359 Reduction of cytosolic Ca++ levels
R-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Protein family/group databases

TCDBi3.A.3.2.1 the p-type atpase (p-atpase) superfamily

Names & Taxonomyi

Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 4Curated (EC:3.6.3.81 Publication)
Short name:
PMCA41 PublicationImported
Alternative name(s):
Matrix-remodeling-associated protein 1
Plasma membrane calcium ATPase isoform 4
Plasma membrane calcium pump isoform 4
Gene namesi
Name:ATP2B4Imported
Synonyms:ATP2B2, MXRA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000058668.14
HGNCiHGNC:817 ATP2B4
MIMi108732 gene
neXtProtiNX_P23634

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 92CytoplasmicSequence analysisAdd BLAST92
Transmembranei93 – 113HelicalSequence analysisAdd BLAST21
Topological domaini114 – 150ExtracellularSequence analysisAdd BLAST37
Transmembranei151 – 171HelicalSequence analysisAdd BLAST21
Topological domaini172 – 356CytoplasmicSequence analysisAdd BLAST185
Transmembranei357 – 376HelicalSequence analysisAdd BLAST20
Topological domaini377 – 409ExtracellularSequence analysisAdd BLAST33
Transmembranei410 – 427HelicalSequence analysisAdd BLAST18
Topological domaini428 – 840CytoplasmicSequence analysisAdd BLAST413
Transmembranei841 – 860HelicalSequence analysisAdd BLAST20
Topological domaini861 – 870ExtracellularSequence analysis10
Transmembranei871 – 891HelicalSequence analysisAdd BLAST21
Topological domaini892 – 911CytoplasmicSequence analysisAdd BLAST20
Transmembranei912 – 934HelicalSequence analysisAdd BLAST23
Topological domaini935 – 952ExtracellularSequence analysisAdd BLAST18
Transmembranei953 – 974HelicalSequence analysisAdd BLAST22
Topological domaini975 – 993CytoplasmicSequence analysisAdd BLAST19
Transmembranei994 – 1015HelicalSequence analysisAdd BLAST22
Topological domaini1016 – 1025ExtracellularSequence analysis10
Transmembranei1026 – 1047HelicalSequence analysisAdd BLAST22
Topological domaini1048 – 1241CytoplasmicSequence analysisAdd BLAST194

Keywords - Cellular componenti

Cell membrane, Cell projection, Cilium, Flagellum, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi672D → Q: Strongly decreased calcium transport activity. Slowed decomposition of the phosphorylated intermediate. 1 Publication1
Mutagenesisi674V → P: Decreased calcium transport activity. 1 Publication1
Mutagenesisi675R → K, D or L: Decreased calcium transport activity. 1 Publication1
Mutagenesisi686K → L: Decreased calcium transport activity. 1 Publication1
Mutagenesisi693R → I: Mildly decreased calcium transport activity. 1 Publication1

Organism-specific databases

DisGeNETi493
OpenTargetsiENSG00000058668
PharmGKBiPA25110

Polymorphism and mutation databases

BioMutaiATP2B4
DMDMi14286105

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000462201 – 1241Plasma membrane calcium-transporting ATPase 4Add BLAST1241

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei1102Phosphothreonine; by PKCBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP23634
MaxQBiP23634
PaxDbiP23634
PeptideAtlasiP23634
PRIDEiP23634
ProteomicsDBi54137
54138 [P23634-2]
54139 [P23634-3]
54140 [P23634-4]
54141 [P23634-5]
54142 [P23634-6]
54143 [P23634-7]
54144 [P23634-8]

PTM databases

iPTMnetiP23634
PhosphoSitePlusiP23634
SwissPalmiP23634

Expressioni

Tissue specificityi

Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex.1 Publication

Gene expression databases

BgeeiENSG00000058668 Expressed in 243 organ(s), highest expression level in myometrium
CleanExiHS_ATP2B2
HS_ATP2B4
ExpressionAtlasiP23634 baseline and differential
GenevisibleiP23634 HS

Organism-specific databases

HPAiCAB016118
HPA040431

Interactioni

Subunit structurei

Interacts with PDZD11 (PubMed:12763866). Interacts with SLC35G1 and STIM1 (PubMed:22084111). Interacts with calmodulin (PubMed:2963820, PubMed:10493800).4 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi106983, 65 interactors
DIPiDIP-6128N
ELMiP23634
IntActiP23634, 31 interactors
MINTiP23634
STRINGi9606.ENSP00000350310

Structurei

Secondary structure

11241
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP23634
SMRiP23634
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP23634

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1086 – 1103Calmodulin-binding subdomain A1 PublicationAdd BLAST18
Regioni1104 – 1113Calmodulin-binding subdomain BBy similarity10

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0204 Eukaryota
ENOG410XNNC LUCA
GeneTreeiENSGT00510000046331
HOVERGENiHBG061286
InParanoidiP23634
KOiK05850
OMAiNAVDCNQ
PhylomeDBiP23634
TreeFamiTF300330

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 2 hits
InterProiView protein in InterPro
IPR034304 ATP2B4
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase
PANTHERiPTHR24093:SF276 PTHR24093:SF276, 1 hit
PfamiView protein in Pfam
PF12424 ATP_Ca_trans_C, 2 hits
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 2 hits
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 3 hits
TIGRFAMsiTIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket
Note: There is a combination of two alternatively spliced domains at N-terminal site A (X and Z) and at C-terminal site B/C (A, B, D and K). The splice sites have mostly been studied independently. Full isoforms so far detected are isoform XA and isoform XB. Experimental confirmation may be lacking for some isoforms.

This entry has 8 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform XD (identifier: P23634-1) [UniParc]FASTAAdd to basket
Also known as: AIICIV

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTNPSDRVLP ANSMAESREG DFGCTVMELR KLMELRSRDA LTQINVHYGG
60 70 80 90 100
VQNLCSRLKT SPVEGLSGNP ADLEKRRQVF GHNVIPPKKP KTFLELVWEA
110 120 130 140 150
LQDVTLIILE IAAIISLVLS FYRPAGEENE LCGQVATTPE DENEAQAGWI
160 170 180 190 200
EGAAILFSVI IVVLVTAFND WSKEKQFRGL QCRIEQEQKF SIIRNGQLIQ
210 220 230 240 250
LPVAEIVVGD IAQVKYGDLL PADGILIQGN DLKIDESSLT GESDHVKKSL
260 270 280 290 300
DKDPMLLSGT HVMEGSGRMV VTAVGVNSQT GIILTLLGVN EDDEGEKKKK
310 320 330 340 350
GKKQGVPENR NKAKTQDGVA LEIQPLNSQE GIDNEEKDKK AVKVPKKEKS
360 370 380 390 400
VLQGKLTRLA VQIGKAGLLM SALTVFILIL YFVIDNFVIN RRPWLPECTP
410 420 430 440 450
IYIQYFVKFF IIGITVLVVA VPEGLPLAVT ISLAYSVKKM MKDNNLVRHL
460 470 480 490 500
DACETMGNAT AICSDKTGTL TMNRMTVVQA YIGGIHYRQI PSPDVFLPKV
510 520 530 540 550
LDLIVNGISI NSAYTSKILP PEKEGGLPRQ VGNKTECALL GFVTDLKQDY
560 570 580 590 600
QAVRNEVPEE KLYKVYTFNS VRKSMSTVIR NPNGGFRMYS KGASEIILRK
610 620 630 640 650
CNRILDRKGE AVPFKNKDRD DMVRTVIEPM ACDGLRTICI AYRDFDDTEP
660 670 680 690 700
SWDNENEILT ELTCIAVVGI EDPVRPEVPD AIAKCKQAGI TVRMVTGDNI
710 720 730 740 750
NTARAIATKC GILTPGDDFL CLEGKEFNRL IRNEKGEVEQ EKLDKIWPKL
760 770 780 790 800
RVLARSSPTD KHTLVKGIID STVGEHRQVV AVTGDGTNDG PALKKADVGF
810 820 830 840 850
AMGIAGTDVA KEASDIILTD DNFTSIVKAV MWGRNVYDSI SKFLQFQLTV
860 870 880 890 900
NVVAVIVAFT GACITQDSPL KAVQMLWVNL IMDTFASLAL ATEPPTESLL
910 920 930 940 950
KRRPYGRNKP LISRTMMKNI LGHAFYQLIV IFILVFAGEK FFDIDSGRKA
960 970 980 990 1000
PLHSPPSQHY TIVFNTFVLM QLFNEINSRK IHGEKNVFSG IYRNIIFCSV
1010 1020 1030 1040 1050
VLGTFICQIF IVEFGGKPFS CTSLSLSQWL WCLFIGIGEL LWGQFISAIP
1060 1070 1080 1090 1100
TRSLKFLKEA GHGTTKEEIT KDAEGLDEID HAEMELRRGQ ILWFRGLNRI
1110 1120 1130 1140 1150
QTQIDVINTF QTGASFKGVL RRQNMGQHLD VKLVPSSSYI KVVKAFHSSL
1160 1170 1180 1190 1200
HESIQKPYNQ KSIHSFMTHP EFAIEEELPR TPLLDEEEEE NPDKASKFGT
1210 1220 1230 1240
RVLLLDGEVT PYANTNNNAV DCNQVQLPQS DSSLQSLETS V
Length:1,241
Mass (Da):137,920
Last modified:June 1, 2001 - v2
Checksum:i568544103CD5F494
GO
Isoform XA (identifier: P23634-2) [UniParc]FASTAAdd to basket
Also known as: AIICII

The sequence of this isoform differs from the canonical sequence as follows:
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,170
Mass (Da):129,403
Checksum:iC4ED2E2EFE1BB043
GO
Isoform ZA (identifier: P23634-3) [UniParc]FASTAAdd to basket
Also known as: AICII

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,158
Mass (Da):128,066
Checksum:iE7AA8CC9C25E0727
GO
Isoform XK (identifier: P23634-4) [UniParc]FASTAAdd to basket
Also known as: XG

The sequence of this isoform differs from the canonical sequence as follows:
     1009-1044: Missing.
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,134
Mass (Da):125,344
Checksum:i088F8CB994D46238
GO
Isoform ZK (identifier: P23634-5) [UniParc]FASTAAdd to basket
Also known as: ZG

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.
     1009-1044: Missing.
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,122
Mass (Da):124,007
Checksum:i4AD4378ED226853B
GO
Isoform XB (identifier: P23634-6) [UniParc]FASTAAdd to basket
Also known as: AIICI, hPMCA4b

The sequence of this isoform differs from the canonical sequence as follows:
     1104-1139: Missing.

Show »
Length:1,205
Mass (Da):133,931
Checksum:i76CE806974035974
GO
Isoform ZB (identifier: P23634-7) [UniParc]FASTAAdd to basket
Also known as: AICI

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.
     1104-1139: Missing.

Show »
Length:1,193
Mass (Da):132,594
Checksum:i6AA34BD1850CADB7
GO
Isoform ZD (identifier: P23634-8) [UniParc]FASTAAdd to basket
Also known as: AICIV

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.

Show »
Length:1,229
Mass (Da):136,584
Checksum:i5E9E48B86464E926
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZS8H7BZS8_HUMAN
Plasma membrane calcium-transportin...
ATP2B4
117Annotation score:
H7BY13H7BY13_HUMAN
Plasma membrane calcium-transportin...
ATP2B4
129Annotation score:
H0YDG5H0YDG5_HUMAN
Plasma membrane calcium-transportin...
ATP2B4
102Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti492S → C in CAD97686 (PubMed:17974005).Curated1
Sequence conflicti1144K → N AA sequence (PubMed:2963820).Curated1
Sequence conflicti1147H → S AA sequence (PubMed:2963820).Curated1
Sequence conflicti1153S → F AA sequence (PubMed:2963820).Curated1
Sequence conflicti1178L → Q AA sequence (PubMed:2966397).Curated1
Sequence conflicti1187E → Q AA sequence (PubMed:2966397).Curated1
Sequence conflicti1190E → G in CAD97686 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000402301 – 312Missing in isoform ZA, isoform ZK, isoform ZB and isoform ZD. CuratedAdd BLAST12
Alternative sequenceiVSP_0004031009 – 1044Missing in isoform XK and isoform ZK. CuratedAdd BLAST36
Alternative sequenceiVSP_0004041104 – 1139Missing in isoform XB and isoform ZB. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_0004051140 – 1241IKVVK…LETSV → VAVAPVKSSPTTSVPAVSSP PMGNQSGQSVP in isoform XA, isoform XK, isoform ZA and isoform ZK. 2 PublicationsAdd BLAST102

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25874 mRNA Translation: AAA50819.1
M83363 mRNA Translation: AAA36455.1
BX537444 mRNA Translation: CAD97686.1
U42026 mRNA Translation: AAB17577.1
U42061 mRNA Translation: AAB17578.1
U42062 mRNA Translation: AAB17579.1
U42378 mRNA Translation: AAB17580.1
AC114402 Genomic DNA No translation available.
AL513343 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91483.1
CH471067 Genomic DNA Translation: EAW91486.1
BC140774 mRNA Translation: AAI40775.1
CCDSiCCDS1440.1 [P23634-6]
CCDS30977.1 [P23634-2]
PIRiA35547
RefSeqiNP_001001396.1, NM_001001396.2 [P23634-2]
NP_001675.3, NM_001684.4 [P23634-6]
UniGeneiHs.343522
Hs.733333

Genome annotation databases

EnsembliENST00000341360; ENSP00000340930; ENSG00000058668 [P23634-2]
ENST00000357681; ENSP00000350310; ENSG00000058668 [P23634-6]
ENST00000367218; ENSP00000356187; ENSG00000058668 [P23634-2]
GeneIDi493
KEGGihsa:493
UCSCiuc001gzv.4 human [P23634-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25874 mRNA Translation: AAA50819.1
M83363 mRNA Translation: AAA36455.1
BX537444 mRNA Translation: CAD97686.1
U42026 mRNA Translation: AAB17577.1
U42061 mRNA Translation: AAB17578.1
U42062 mRNA Translation: AAB17579.1
U42378 mRNA Translation: AAB17580.1
AC114402 Genomic DNA No translation available.
AL513343 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91483.1
CH471067 Genomic DNA Translation: EAW91486.1
BC140774 mRNA Translation: AAI40775.1
CCDSiCCDS1440.1 [P23634-6]
CCDS30977.1 [P23634-2]
PIRiA35547
RefSeqiNP_001001396.1, NM_001001396.2 [P23634-2]
NP_001675.3, NM_001684.4 [P23634-6]
UniGeneiHs.343522
Hs.733333

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CFFNMR-B1086-1104[»]
2KNENMR-B1086-1149[»]
ProteinModelPortaliP23634
SMRiP23634
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106983, 65 interactors
DIPiDIP-6128N
ELMiP23634
IntActiP23634, 31 interactors
MINTiP23634
STRINGi9606.ENSP00000350310

Protein family/group databases

TCDBi3.A.3.2.1 the p-type atpase (p-atpase) superfamily

PTM databases

iPTMnetiP23634
PhosphoSitePlusiP23634
SwissPalmiP23634

Polymorphism and mutation databases

BioMutaiATP2B4
DMDMi14286105

Proteomic databases

EPDiP23634
MaxQBiP23634
PaxDbiP23634
PeptideAtlasiP23634
PRIDEiP23634
ProteomicsDBi54137
54138 [P23634-2]
54139 [P23634-3]
54140 [P23634-4]
54141 [P23634-5]
54142 [P23634-6]
54143 [P23634-7]
54144 [P23634-8]

Protocols and materials databases

DNASUi493
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341360; ENSP00000340930; ENSG00000058668 [P23634-2]
ENST00000357681; ENSP00000350310; ENSG00000058668 [P23634-6]
ENST00000367218; ENSP00000356187; ENSG00000058668 [P23634-2]
GeneIDi493
KEGGihsa:493
UCSCiuc001gzv.4 human [P23634-1]

Organism-specific databases

CTDi493
DisGeNETi493
EuPathDBiHostDB:ENSG00000058668.14
GeneCardsiATP2B4
HGNCiHGNC:817 ATP2B4
HPAiCAB016118
HPA040431
MIMi108732 gene
neXtProtiNX_P23634
OpenTargetsiENSG00000058668
PharmGKBiPA25110
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0204 Eukaryota
ENOG410XNNC LUCA
GeneTreeiENSGT00510000046331
HOVERGENiHBG061286
InParanoidiP23634
KOiK05850
OMAiNAVDCNQ
PhylomeDBiP23634
TreeFamiTF300330

Enzyme and pathway databases

ReactomeiR-HSA-418359 Reduction of cytosolic Ca++ levels
R-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Miscellaneous databases

ChiTaRSiATP2B4 human
EvolutionaryTraceiP23634
GeneWikiiATP2B4
GenomeRNAii493
PROiPR:P23634
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000058668 Expressed in 243 organ(s), highest expression level in myometrium
CleanExiHS_ATP2B2
HS_ATP2B4
ExpressionAtlasiP23634 baseline and differential
GenevisibleiP23634 HS

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 2 hits
InterProiView protein in InterPro
IPR034304 ATP2B4
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase
PANTHERiPTHR24093:SF276 PTHR24093:SF276, 1 hit
PfamiView protein in Pfam
PF12424 ATP_Ca_trans_C, 2 hits
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 2 hits
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 3 hits
TIGRFAMsiTIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiAT2B4_HUMAN
AccessioniPrimary (citable) accession number: P23634
Secondary accession number(s): B1APW5
, B1APW6, Q13450, Q13452, Q13455, Q16817, Q7Z3S1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: June 1, 2001
Last modified: October 10, 2018
This is version 197 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again