Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P23560 (BDNF_HUMAN)

Entry version 198 (05 Jun 2019)
Sequence version 1 (01 Nov 1991)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Brain-derived neurotrophic factor

Gene

BDNF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • growth factor activity Source: GO_Central
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-9022702 MECP2 regulates transcription of neuronal ligands
R-HSA-9024909 BDNF activates NTRK2 (TRKB) signaling
R-HSA-9026519 Activated NTRK2 signals through RAS
R-HSA-9026527 Activated NTRK2 signals through PLCG1
R-HSA-9028335 Activated NTRK2 signals through PI3K
R-HSA-9028731 Activated NTRK2 signals through FRS2 and FRS3
R-HSA-9032500 Activated NTRK2 signals through FYN
R-HSA-9032759 NTRK2 activates RAC1
R-HSA-9032845 Activated NTRK2 signals through CDK5

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P23560

SIGNOR Signaling Network Open Resource

More...SIGNORi		P23560

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Brain-derived neurotrophic factor
Short name:
BDNF
Alternative name(s):
Abrineurin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BDNF1 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1033 BDNF

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		113505 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P23560

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Congenital central hypoventilation syndrome (CCHS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionRare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0182602T → I in CCHS. 1 PublicationCorresponds to variant dbSNP:rs8192466Ensembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi54R → A: Abolishes processing by S1P. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		627

MalaCards human disease database

More...MalaCardsi		BDNF
MIMi209880 phenotype

Open Targets

More...OpenTargetsi		ENSG00000176697

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		661 Ondine syndrome
893 WAGR syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31891

Chemistry databases

Drug and drug target database

More...DrugBanki		DB05047 CX717

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BDNF

Domain mapping of disease mutations (DMDM)

More...DMDMi		114900

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Sequence analysisAdd BLAST18
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000001963319 – 1281 PublicationAdd BLAST110
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000019634129 – 247Brain-derived neurotrophic factorAdd BLAST119

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi121N-linked (GlcNAc...) asparagine1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi141 ↔ 208
Disulfide bondi186 ↔ 237
Disulfide bondi196 ↔ 239

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei57 – 58Cleavage; by S1P2

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P23560

PeptideAtlas

More...PeptideAtlasi		P23560

PRoteomics IDEntifications database

More...PRIDEi		P23560

ProteomicsDB human proteome resource

More...ProteomicsDBi		54129
54130 [P23560-2]
54131 [P23560-3]
54132 [P23560-4]
54133 [P23560-5]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P23560-2 [P23560-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P23560

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P23560

Miscellaneous databases

CutDB - Proteolytic event database

More...PMAP-CutDBi		P23560

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000176697 Expressed in 147 organ(s), highest expression level in saphenous vein

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P23560 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P23560 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB009564
HPA031440
HPA056104

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomers and homodimers. Binds to NTRK2/TRKB.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
NTF4P341305EBI-1026003,EBI-3907456

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		107096, 10 interactors

Database of interacting proteins

More...DIPi		DIP-5719N

Protein interaction database and analysis system

More...IntActi		P23560, 11 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000414303

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1247
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P23560

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P23560

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NGF-beta family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IH7X Eukaryota
ENOG410XRPH LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000007725

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P23560

KEGG Orthology (KO)

More...KOi		K04355

Identification of Orthologs from Complete Genome Data

More...OMAi		RVGWRFI

Database of Orthologous Groups

More...OrthoDBi		1156054at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P23560

TreeFam database of animal gene trees

More...TreeFami		TF106463

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.10.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR020430 Brain-der_neurotrophic_factor
IPR029034 Cystine-knot_cytokine
IPR020408 Nerve_growth_factor-like
IPR002072 Nerve_growth_factor-rel
IPR019846 Nerve_growth_factor_CS

The PANTHER Classification System

More...PANTHERi		PTHR11589 PTHR11589, 1 hit
PTHR11589:SF3 PTHR11589:SF3, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00243 NGF, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF001789 NGF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01912 BDNFACTOR
PR00268 NGF

ProDom; a protein domain database

More...ProDomi		View protein in ProDom or Entries sharing at least one domain
PD002052 Nerve_growth_factor-rel, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00140 NGF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57501 SSF57501, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00248 NGF_1, 1 hit
PS50270 NGF_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: 2 types of transcripts are produced: non-coding transcripts (antisense, opposite strand (OS), 8 exons) and coding transcripts (11 exons). Brain BDNF and anti-BDNF transcripts form dsRNA duplexes.

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P23560-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTILFLTMVI SYFGCMKAAP MKEANIRGQG GLAYPGVRTH GTLESVNGPK 
        60         70         80         90        100
AGSRGLTSLA DTFEHVIEEL LDEDQKVRPN EENNKDADLY TSRVMLSSQV 
       110        120        130        140        150
PLEPPLLFLL EEYKNYLDAA NMSMRVRRHS DPARRGELSV CDSISEWVTA 
       160        170        180        190        200
ADKKTAVDMS GGTVTVLEKV PVSKGQLKQY FYETKCNPMG YTKEGCRGID 
       210        220        230        240 
KRHWNSQCRT TQSYVRALTM DSKKRIGWRF IRIDTSCVCT LTIKRGR
Length:247
Mass (Da):27,818
Last modified:November 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0A60488254722A99
GO
Isoform 2 (identifier: P23560-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFHQVRRVM

Show »
Length:255
Mass (Da):28,872
Checksum:i0E3881F4944CA23C
GO
Isoform 3 (identifier: P23560-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQSREEEWFHQVRRVM

Show »
Length:262
Mass (Da):29,817
Checksum:i28DDC6F9E19BC727
GO
Isoform 4 (identifier: P23560-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCGATSFLHE...IKFHQVRRVM

Show »
Length:329
Mass (Da):37,120
Checksum:i5D19D9F2F62588FA
GO
Isoform 5 (identifier: P23560-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLCAISLCARVRKLRSAGRCGKFHQVRRVM

Show »
Length:276
Mass (Da):31,116
Checksum:iB7B42AA52E6C1A9C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PMP3E9PMP3_HUMAN
Brain-derived neurotrophic factor
BDNF
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0182602T → I in CCHS. 1 PublicationCorresponds to variant dbSNP:rs8192466Ensembl.1
Natural variantiVAR_00462666V → M Polymorphism; strongly associated with susceptibility to eating disorders such as anorexia nervosa and bulimia nervosa; associated with poorer episodic memory; may have a protective effect in obsessive-compulsive disorder; impairs localization to secretory granules or synapses. 7 PublicationsCorresponds to variant dbSNP:rs6265EnsemblClinVar.1
Natural variantiVAR_01179775Q → H. Corresponds to variant dbSNP:rs1048218Ensembl.1
Natural variantiVAR_080766122M → T Found in a small consanguineous family with intellectual disability; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs765594245Ensembl.1
Natural variantiVAR_011798125R → M. Corresponds to variant dbSNP:rs1048220Ensembl.1
Natural variantiVAR_011799127R → L. Corresponds to variant dbSNP:rs1048221Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0379481M → MFHQVRRVM in isoform 2. 3 Publications1
Alternative sequenceiVSP_0380991M → MQSREEEWFHQVRRVM in isoform 3. 2 Publications1
Alternative sequenceiVSP_0381001M → MCGATSFLHECTRLILVTTQ NAEFLQKGLQVHTCFGVYPH ASVWHDCASQKKGCAVYLHV SVEFNKLIPENGFIKFHQVR RVM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0381011M → MLCAISLCARVRKLRSAGRC GKFHQVRRVM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M37762 Genomic DNA Translation: AAA51820.1
M61176 mRNA Translation: AAA69805.2
M61181 Genomic DNA Translation: AAA96140.1
X60201 mRNA Translation: CAA42761.1
AY054392 mRNA Translation: AAL23557.2
AY054393 mRNA Translation: AAL23558.1
AY054394 mRNA Translation: AAL23559.1
AY054395 mRNA Translation: AAL23560.1
AY054396 mRNA Translation: AAL23561.1
AY054397 mRNA Translation: AAL23562.1
AY054398 mRNA Translation: AAL23563.1
AY054399 mRNA Translation: AAL23564.1
AY054400 mRNA Translation: AAL23565.2
AF411339 Genomic DNA Translation: AAO15434.1
EF674517 mRNA Translation: ABS29021.1
EF674518 mRNA Translation: ABS29022.1
EF674519 mRNA Translation: ABS29023.1
EF674520 mRNA Translation: ABS29024.1
EF674521 mRNA Translation: ABS29025.1
EF689009 mRNA Translation: ABS32249.1
EF689010 mRNA Translation: ABS32250.1
EF689011 mRNA Translation: ABS32251.1
EF689012 mRNA Translation: ABS32252.1
EF689013 mRNA Translation: ABS32253.1
EF689014 mRNA Translation: ABS32254.1
EF689015 mRNA Translation: ABS32255.1
EF689016 mRNA Translation: ABS32256.1
EF689017 mRNA Translation: ABS32257.1
EF689018 mRNA Translation: ABS32258.1
EF689019 mRNA Translation: ABS32259.1
EF689020 mRNA Translation: ABS32260.1
EF689021 mRNA Translation: ABS32261.1
X91251 mRNA Translation: CAA62632.1
AF400438 mRNA Translation: AAK92487.1
AY656701 mRNA Translation: AAT74399.1
AK289853 mRNA Translation: BAF82542.1
AK289763 mRNA Translation: BAF82452.1
AC104563 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68274.1
CH471064 Genomic DNA Translation: EAW68278.1
CH471064 Genomic DNA Translation: EAW68279.1
CH471064 Genomic DNA Translation: EAW68275.1
CH471064 Genomic DNA Translation: EAW68276.1
CH471064 Genomic DNA Translation: EAW68277.1
BC029795 mRNA Translation: AAH29795.1
AY011481 Genomic DNA Translation: AAG47514.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41628.1 [P23560-3]
CCDS44558.1 [P23560-4]
CCDS7865.1 [P23560-2]
CCDS7866.1 [P23560-1]

Protein sequence database of the Protein Information Resource

More...PIRi		B36208 A40304

NCBI Reference Sequences

More...RefSeqi		NP_001137277.1, NM_001143805.1 [P23560-1]
NP_001137278.1, NM_001143806.1 [P23560-1]
NP_001137279.1, NM_001143807.1 [P23560-1]
NP_001137280.1, NM_001143808.1 [P23560-1]
NP_001137281.1, NM_001143809.1 [P23560-5]
NP_001137282.1, NM_001143810.1 [P23560-4]
NP_001137283.1, NM_001143811.1 [P23560-1]
NP_001137284.1, NM_001143812.1 [P23560-1]
NP_001137285.1, NM_001143813.1 [P23560-1]
NP_001137286.1, NM_001143814.1 [P23560-1]
NP_001137288.1, NM_001143816.1 [P23560-1]
NP_001700.2, NM_001709.4 [P23560-1]
NP_733927.1, NM_170731.4 [P23560-2]
NP_733928.1, NM_170732.4 [P23560-1]
NP_733929.1, NM_170733.3 [P23560-1]
NP_733930.1, NM_170734.3 [P23560-3]
NP_733931.1, NM_170735.5 [P23560-1]
XP_011518582.1, XM_011520280.2 [P23560-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000314915; ENSP00000320002; ENSG00000176697 [P23560-2]
ENST00000356660; ENSP00000349084; ENSG00000176697 [P23560-1]
ENST00000395978; ENSP00000379302; ENSG00000176697 [P23560-1]
ENST00000395980; ENSP00000379304; ENSG00000176697 [P23560-1]
ENST00000395981; ENSP00000379305; ENSG00000176697 [P23560-1]
ENST00000395983; ENSP00000379307; ENSG00000176697 [P23560-1]
ENST00000395986; ENSP00000379309; ENSG00000176697 [P23560-3]
ENST00000418212; ENSP00000400502; ENSG00000176697 [P23560-1]
ENST00000420794; ENSP00000389564; ENSG00000176697 [P23560-1]
ENST00000438929; ENSP00000414303; ENSG00000176697 [P23560-4]
ENST00000439476; ENSP00000389345; ENSG00000176697 [P23560-1]
ENST00000525528; ENSP00000437138; ENSG00000176697 [P23560-1]
ENST00000525950; ENSP00000432035; ENSG00000176697 [P23560-1]
ENST00000530861; ENSP00000435564; ENSG00000176697 [P23560-1]
ENST00000532997; ENSP00000435805; ENSG00000176697 [P23560-1]
ENST00000533131; ENSP00000432727; ENSG00000176697 [P23560-1]
ENST00000533246; ENSP00000432376; ENSG00000176697 [P23560-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		627

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:627

UCSC genome browser

More...UCSCi		uc001mrt.4 human [P23560-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

BDNF entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M37762 Genomic DNA Translation: AAA51820.1
M61176 mRNA Translation: AAA69805.2
M61181 Genomic DNA Translation: AAA96140.1
X60201 mRNA Translation: CAA42761.1
AY054392 mRNA Translation: AAL23557.2
AY054393 mRNA Translation: AAL23558.1
AY054394 mRNA Translation: AAL23559.1
AY054395 mRNA Translation: AAL23560.1
AY054396 mRNA Translation: AAL23561.1
AY054397 mRNA Translation: AAL23562.1
AY054398 mRNA Translation: AAL23563.1
AY054399 mRNA Translation: AAL23564.1
AY054400 mRNA Translation: AAL23565.2
AF411339 Genomic DNA Translation: AAO15434.1
EF674517 mRNA Translation: ABS29021.1
EF674518 mRNA Translation: ABS29022.1
EF674519 mRNA Translation: ABS29023.1
EF674520 mRNA Translation: ABS29024.1
EF674521 mRNA Translation: ABS29025.1
EF689009 mRNA Translation: ABS32249.1
EF689010 mRNA Translation: ABS32250.1
EF689011 mRNA Translation: ABS32251.1
EF689012 mRNA Translation: ABS32252.1
EF689013 mRNA Translation: ABS32253.1
EF689014 mRNA Translation: ABS32254.1
EF689015 mRNA Translation: ABS32255.1
EF689016 mRNA Translation: ABS32256.1
EF689017 mRNA Translation: ABS32257.1
EF689018 mRNA Translation: ABS32258.1
EF689019 mRNA Translation: ABS32259.1
EF689020 mRNA Translation: ABS32260.1
EF689021 mRNA Translation: ABS32261.1
X91251 mRNA Translation: CAA62632.1
AF400438 mRNA Translation: AAK92487.1
AY656701 mRNA Translation: AAT74399.1
AK289853 mRNA Translation: BAF82542.1
AK289763 mRNA Translation: BAF82452.1
AC104563 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68274.1
CH471064 Genomic DNA Translation: EAW68278.1
CH471064 Genomic DNA Translation: EAW68279.1
CH471064 Genomic DNA Translation: EAW68275.1
CH471064 Genomic DNA Translation: EAW68276.1
CH471064 Genomic DNA Translation: EAW68277.1
BC029795 mRNA Translation: AAH29795.1
AY011481 Genomic DNA Translation: AAG47514.1
CCDSiCCDS41628.1 [P23560-3]
CCDS44558.1 [P23560-4]
CCDS7865.1 [P23560-2]
CCDS7866.1 [P23560-1]
PIRiB36208 A40304
RefSeqiNP_001137277.1, NM_001143805.1 [P23560-1]
NP_001137278.1, NM_001143806.1 [P23560-1]
NP_001137279.1, NM_001143807.1 [P23560-1]
NP_001137280.1, NM_001143808.1 [P23560-1]
NP_001137281.1, NM_001143809.1 [P23560-5]
NP_001137282.1, NM_001143810.1 [P23560-4]
NP_001137283.1, NM_001143811.1 [P23560-1]
NP_001137284.1, NM_001143812.1 [P23560-1]
NP_001137285.1, NM_001143813.1 [P23560-1]
NP_001137286.1, NM_001143814.1 [P23560-1]
NP_001137288.1, NM_001143816.1 [P23560-1]
NP_001700.2, NM_001709.4 [P23560-1]
NP_733927.1, NM_170731.4 [P23560-2]
NP_733928.1, NM_170732.4 [P23560-1]
NP_733929.1, NM_170733.3 [P23560-1]
NP_733930.1, NM_170734.3 [P23560-3]
NP_733931.1, NM_170735.5 [P23560-1]
XP_011518582.1, XM_011520280.2 [P23560-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B8MX-ray2.75A129-247[»]
1BNDX-ray2.30A129-247[»]
SMRiP23560
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107096, 10 interactors
DIPiDIP-5719N
IntActiP23560, 11 interactors
STRINGi9606.ENSP00000414303

Chemistry databases

DrugBankiDB05047 CX717

PTM databases

iPTMnetiP23560
PhosphoSitePlusiP23560

Polymorphism and mutation databases

BioMutaiBDNF
DMDMi114900

Proteomic databases

PaxDbiP23560
PeptideAtlasiP23560
PRIDEiP23560
ProteomicsDBi54129
54130 [P23560-2]
54131 [P23560-3]
54132 [P23560-4]
54133 [P23560-5]
TopDownProteomicsiP23560-2 [P23560-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		627
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314915; ENSP00000320002; ENSG00000176697 [P23560-2]
ENST00000356660; ENSP00000349084; ENSG00000176697 [P23560-1]
ENST00000395978; ENSP00000379302; ENSG00000176697 [P23560-1]
ENST00000395980; ENSP00000379304; ENSG00000176697 [P23560-1]
ENST00000395981; ENSP00000379305; ENSG00000176697 [P23560-1]
ENST00000395983; ENSP00000379307; ENSG00000176697 [P23560-1]
ENST00000395986; ENSP00000379309; ENSG00000176697 [P23560-3]
ENST00000418212; ENSP00000400502; ENSG00000176697 [P23560-1]
ENST00000420794; ENSP00000389564; ENSG00000176697 [P23560-1]
ENST00000438929; ENSP00000414303; ENSG00000176697 [P23560-4]
ENST00000439476; ENSP00000389345; ENSG00000176697 [P23560-1]
ENST00000525528; ENSP00000437138; ENSG00000176697 [P23560-1]
ENST00000525950; ENSP00000432035; ENSG00000176697 [P23560-1]
ENST00000530861; ENSP00000435564; ENSG00000176697 [P23560-1]
ENST00000532997; ENSP00000435805; ENSG00000176697 [P23560-1]
ENST00000533131; ENSP00000432727; ENSG00000176697 [P23560-1]
ENST00000533246; ENSP00000432376; ENSG00000176697 [P23560-1]
GeneIDi627
KEGGihsa:627
UCSCiuc001mrt.4 human [P23560-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		627
DisGeNETi627

GeneCards: human genes, protein and diseases

More...GeneCardsi		BDNF

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0035926
HGNCiHGNC:1033 BDNF
HPAiCAB009564
HPA031440
HPA056104
MalaCardsiBDNF
MIMi113505 gene
209880 phenotype
neXtProtiNX_P23560
OpenTargetsiENSG00000176697
Orphaneti661 Ondine syndrome
893 WAGR syndrome
PharmGKBiPA31891

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IH7X Eukaryota
ENOG410XRPH LUCA
GeneTreeiENSGT00390000007725
InParanoidiP23560
KOiK04355
OMAiRVGWRFI
OrthoDBi1156054at2759
PhylomeDBiP23560
TreeFamiTF106463

Enzyme and pathway databases

ReactomeiR-HSA-9022702 MECP2 regulates transcription of neuronal ligands
R-HSA-9024909 BDNF activates NTRK2 (TRKB) signaling
R-HSA-9026519 Activated NTRK2 signals through RAS
R-HSA-9026527 Activated NTRK2 signals through PLCG1
R-HSA-9028335 Activated NTRK2 signals through PI3K
R-HSA-9028731 Activated NTRK2 signals through FRS2 and FRS3
R-HSA-9032500 Activated NTRK2 signals through FYN
R-HSA-9032759 NTRK2 activates RAC1
R-HSA-9032845 Activated NTRK2 signals through CDK5
SignaLinkiP23560
SIGNORiP23560

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BDNF human
EvolutionaryTraceiP23560

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Brain-derived_neurotrophic_factor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		627
PMAP-CutDBiP23560

Protein Ontology

More...PROi		PR:P23560

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000176697 Expressed in 147 organ(s), highest expression level in saphenous vein
ExpressionAtlasiP23560 baseline and differential
GenevisibleiP23560 HS

Family and domain databases

Gene3Di2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR020430 Brain-der_neurotrophic_factor
IPR029034 Cystine-knot_cytokine
IPR020408 Nerve_growth_factor-like
IPR002072 Nerve_growth_factor-rel
IPR019846 Nerve_growth_factor_CS
PANTHERiPTHR11589 PTHR11589, 1 hit
PTHR11589:SF3 PTHR11589:SF3, 1 hit
PfamiView protein in Pfam
PF00243 NGF, 1 hit
PIRSFiPIRSF001789 NGF, 1 hit
PRINTSiPR01912 BDNFACTOR
PR00268 NGF
ProDomiView protein in ProDom or Entries sharing at least one domain
PD002052 Nerve_growth_factor-rel, 1 hit
SMARTiView protein in SMART
SM00140 NGF, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit
PROSITEiView protein in PROSITE
PS00248 NGF_1, 1 hit
PS50270 NGF_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBDNF_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P23560
Secondary accession number(s): A7LA85
, A7LA92, D3DQZ2, Q598Q1, Q6DN19, Q6YNR2, Q6YNR3, Q9BYY7, Q9UC24
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 1, 1991
Last modified: June 5, 2019
This is version 198 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again