Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P23510 (TNFL4_HUMAN)

Entry version 171 (07 Apr 2021)
Sequence version 1 (01 Nov 1991)
Previous versions | rss
Add a publicationFeedback
Protein

Tumor necrosis factor ligand superfamily member 4

Gene

TNFSF4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P23510

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5669034, TNFs bind their physiological receptors

SIGNOR Signaling Network Open Resource

More...SIGNORi		P23510

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor necrosis factor ligand superfamily member 4
Alternative name(s):
Glycoprotein Gp34
OX40 ligand
Short name:
OX40L
TAX transcriptionally-activated glycoprotein 1
CD_antigen: CD252
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNFSF4
Synonyms:TXGP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11934, TNFSF4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603594, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P23510

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000117586.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 23CytoplasmicSequence analysisAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei24 – 50Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST27
Topological domaini51 – 183ExtracellularSequence analysisAdd BLAST133

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Systemic lupus erythematosus (SLE)1 Publication
Disease susceptibility is associated with variants affecting the gene represented in this entry. The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T-cell-APC interaction and the functional consequences of T-cell activation, thereby destabilizing peripheral tolerance.
Disease descriptionA chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow.
Related information in OMIM

Keywords - Diseasei

Systemic lupus erythematosus

Organism-specific databases

DisGeNET

More...DisGeNETi		7292

MalaCards human disease database

More...MalaCardsi		TNFSF4
MIMi152700, phenotype

Open Targets

More...OpenTargetsi		ENSG00000117586

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2073, Narcolepsy type 1
536, Systemic lupus erythematosus

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36625

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P23510, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3712900

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TNFSF4

Domain mapping of disease mutations (DMDM)

More...DMDMi		121540

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001854931 – 183Tumor necrosis factor ligand superfamily member 4Add BLAST183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi90N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi97 ↔ 1811 Publication
Glycosylationi114N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi152N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi157N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P23510

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P23510

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P23510

PeptideAtlas

More...PeptideAtlasi		P23510

PRoteomics IDEntifications database

More...PRIDEi		P23510

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54122 [P23510-1]
70669

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P23510, 4 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P23510

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P23510

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By HTLV-1 transactivator p40-Tax.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000117586, Expressed in monocyte and 148 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P23510, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P23510, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000117586, Tissue enhanced (lymphoid tissue, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

Database of interacting proteins

More...DIPi		DIP-3023N

Protein interaction database and analysis system

More...IntActi		P23510, 3 interactors

Molecular INTeraction database

More...MINTi		P23510

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000281834

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P23510, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1183
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P23510

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P23510

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tumor necrosis factor family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502ST4X, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000015127

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_091735_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P23510

Identification of Orthologs from Complete Genome Data

More...OMAi		NTSCEDF

Database of Orthologous Groups

More...OrthoDBi		1590205at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P23510

TreeFam database of animal gene trees

More...TreeFami		TF336384

Family and domain databases

Conserved Domains Database

More...CDDi		cd00184, TNF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.120.40, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR021184, TNF_CS
IPR006052, TNF_dom
IPR042338, TNFSF4
IPR008983, Tumour_necrosis_fac-like_dom

The PANTHER Classification System

More...PANTHERi		PTHR17534, PTHR17534, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00207, TNF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49842, SSF49842, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00251, TNF_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P23510-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERVQPLEEN VGNAARPRFE RNKLLLVASV IQGLGLLLCF TYICLHFSAL 
        60         70         80         90        100
QVSHRYPRIQ SIKVQFTEYK KEKGFILTSQ KEDEIMKVQN NSVIINCDGF 
       110        120        130        140        150
YLISLKGYFS QEVNISLHYQ KDEEPLFQLK KVRSVNSLMV ASLTYKDKVY 
       160        170        180 
LNVTTDNTSL DDFHVNGGEL ILIHQNPGEF CVL
Length:183
Mass (Da):21,050
Last modified:November 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0D5604AD29D529CF
GO
Isoform 2 (identifier: P23510-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQ → M

Show »
Length:133
Mass (Da):15,427
Checksum:i27AF148E6E528C8F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0562881 – 51MERVQ…FSALQ → M in isoform 2. 2 PublicationsAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D90224 mRNA Translation: BAA14259.1
X79929 mRNA Translation: CAA56284.1
AK297932 mRNA Translation: BAG60249.1
AL022310 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90938.1
BC041663 mRNA Translation: AAH41663.1
AB042988 Genomic DNA Translation: BAB18304.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1306.1 [P23510-1]
CCDS72985.1 [P23510-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A39680

NCBI Reference Sequences

More...RefSeqi		NP_001284491.1, NM_001297562.1 [P23510-2]
NP_003317.1, NM_003326.4 [P23510-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000281834; ENSP00000281834; ENSG00000117586 [P23510-1]
ENST00000367718; ENSP00000356691; ENSG00000117586 [P23510-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7292

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7292

UCSC genome browser

More...UCSCi		uc001giv.4, human [P23510-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90224 mRNA Translation: BAA14259.1
X79929 mRNA Translation: CAA56284.1
AK297932 mRNA Translation: BAG60249.1
AL022310 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90938.1
BC041663 mRNA Translation: AAH41663.1
AB042988 Genomic DNA Translation: BAB18304.1
CCDSiCCDS1306.1 [P23510-1]
CCDS72985.1 [P23510-2]
PIRiA39680
RefSeqiNP_001284491.1, NM_001297562.1 [P23510-2]
NP_003317.1, NM_003326.4 [P23510-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2HEVX-ray2.41F51-183[»]
SMRiP23510
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

DIPiDIP-3023N
IntActiP23510, 3 interactors
MINTiP23510
STRINGi9606.ENSP00000281834

Chemistry databases

ChEMBLiCHEMBL3712900

PTM databases

GlyGeniP23510, 4 sites
iPTMnetiP23510
PhosphoSitePlusiP23510

Genetic variation databases

BioMutaiTNFSF4
DMDMi121540

Proteomic databases

jPOSTiP23510
MassIVEiP23510
PaxDbiP23510
PeptideAtlasiP23510
PRIDEiP23510
ProteomicsDBi54122 [P23510-1]
70669

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P23510, 51 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34389, 736 antibodies

The DNASU plasmid repository

More...DNASUi		7292

Genome annotation databases

EnsembliENST00000281834; ENSP00000281834; ENSG00000117586 [P23510-1]
ENST00000367718; ENSP00000356691; ENSG00000117586 [P23510-2]
GeneIDi7292
KEGGihsa:7292
UCSCiuc001giv.4, human [P23510-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7292
DisGeNETi7292

GeneCards: human genes, protein and diseases

More...GeneCardsi		TNFSF4
HGNCiHGNC:11934, TNFSF4
HPAiENSG00000117586, Tissue enhanced (lymphoid tissue, testis)
MalaCardsiTNFSF4
MIMi152700, phenotype
603594, gene
neXtProtiNX_P23510
OpenTargetsiENSG00000117586
Orphaneti2073, Narcolepsy type 1
536, Systemic lupus erythematosus
PharmGKBiPA36625
VEuPathDBiHostDB:ENSG00000117586.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502ST4X, Eukaryota
GeneTreeiENSGT00390000015127
HOGENOMiCLU_091735_0_0_1
InParanoidiP23510
OMAiNTSCEDF
OrthoDBi1590205at2759
PhylomeDBiP23510
TreeFamiTF336384

Enzyme and pathway databases

PathwayCommonsiP23510
ReactomeiR-HSA-5669034, TNFs bind their physiological receptors
SIGNORiP23510

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7292, 5 hits in 988 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TNFSF4, human
EvolutionaryTraceiP23510

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7292
PharosiP23510, Tbio

Protein Ontology

More...PROi		PR:P23510
RNActiP23510, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000117586, Expressed in monocyte and 148 other tissues
ExpressionAtlasiP23510, baseline and differential
GenevisibleiP23510, HS

Family and domain databases

CDDicd00184, TNF, 1 hit
Gene3Di2.60.120.40, 1 hit
InterProiView protein in InterPro
IPR021184, TNF_CS
IPR006052, TNF_dom
IPR042338, TNFSF4
IPR008983, Tumour_necrosis_fac-like_dom
PANTHERiPTHR17534, PTHR17534, 1 hit
SMARTiView protein in SMART
SM00207, TNF, 1 hit
SUPFAMiSSF49842, SSF49842, 1 hit
PROSITEiView protein in PROSITE
PS00251, TNF_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNFL4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P23510
Secondary accession number(s): Q5JZA5, Q8IV74, Q9HCN9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 1, 1991
Last modified: April 7, 2021
This is version 171 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again