Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P23219 (PGH1_HUMAN)

Entry version 207 (31 Jul 2019)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Prostaglandin G/H synthase 1

Gene

PTGS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.

Miscellaneous

The conversion of arachidonate to prostaglandin H2 is a 2 step reaction: a cyclooxygenase (COX) reaction which converts arachidonate to prostaglandin G2 (PGG2) and a peroxidase reaction in which PGG2 is reduced to prostaglandin H2 (PGH2). The cyclooxygenase reaction occurs in a hydrophobic channel in the core of the enzyme. The peroxidase reaction occurs at a heme-containing active site located near the protein surface. The nonsteroidal anti-inflammatory drugs (NSAIDs) binding site corresponds to the cyclooxygenase active site.
Conversion of arachidonate to prostaglandin H2 is mediated by 2 different isozymes: the constitutive PTGS1 and the inducible PTGS2. PGHS1 is expressed constitutively and generally produces prostanoids acutely in response to hormonal stimuli to fine-tune physiological processes requiring instantaneous, continuous regulation (e.g. hemostasis). PGHS2 is inducible and typically produces prostanoids that mediate responses to physiological stresses such as infection and inflammation.
PTGS1 and PTGS2 are the targets of nonsteroidal anti-inflammatory drugs (NSAIDs) including aspirin and ibuprofen. Aspirin is able to produce an irreversible inactivation of the enzyme through a serine acetylation. Inhibition of the PGHSs with NSAIDs acutely reduces inflammation, pain, and fever, and long-term use of these drugs reduces fatal thrombotic events, as well as the development of colon cancer and Alzheimer's disease. PTGS2 is the principal isozyme responsible for production of inflammatory prostaglandins. New generation PTGSs inhibitors strive to be selective for PTGS2, to avoid side effects such as gastrointestinal complications and ulceration.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

heme bBy similarityNote: Binds 1 heme b (iron(II)-protoporphyrin IX) group per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: prostaglandin biosynthesis

This protein is involved in the pathway prostaglandin biosynthesis, which is part of Lipid metabolism.
View all proteins of this organism that are known to be involved in the pathway prostaglandin biosynthesis and in Lipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei206Proton acceptorPROSITE-ProRule annotation1
Active sitei384For cyclooxygenase activityBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi387Iron (heme axial ligand)PROSITE-ProRule annotation1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei529Aspirin-acetylated serine1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDioxygenase, Oxidoreductase, Peroxidase
Biological processFatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS01815-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		1.14.99.1 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-140180 COX reactions
R-HSA-2162123 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P23219

SIGNOR Signaling Network Open Resource

More...SIGNORi		P23219

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00662

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		P23219 Curated

PeroxiBase, a peroxidase database

More...PeroxiBasei		3320 HsPGHS01

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001103

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Prostaglandin G/H synthase 1 (EC:1.14.99.1)
Alternative name(s):
Cyclooxygenase-1
Short name:
COX-1
Prostaglandin H2 synthase 1
Short name:
PGH synthase 1
Short name:
PGHS-1
Short name:
PHS 1
Prostaglandin-endoperoxide synthase 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTGS1
Synonyms:COX1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9604 PTGS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		176805 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P23219

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi529S → N: Abolishes cyclooxygenase activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5742

Open Targets

More...OpenTargetsi		ENSG00000095303

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24346

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL221

Drug and drug target database

More...DrugBanki		DB02773 (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid
DB07983 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID
DB07981 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1R)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB07984 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1S)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB02198 2-Bromoacetyl Group
DB06736 Aceclofenac
DB00316 Acetaminophen
DB03667 Acetic Acid Salicyloyl-Amino-Ester
DB00945 Acetylsalicylic acid
DB01435 Antipyrine
DB01419 Antrafenine
DB04557 Arachidonic Acid
DB01014 Balsalazide
DB02379 Beta-D-Glucose
DB00963 Bromfenac
DB00796 Candesartan
DB00821 Carprofen
DB01136 Carvedilol
DB00672 Chlorpropamide
DB00250 Dapsone
DB00035 Desmopressin
DB00829 Diazepam
DB00586 Diclofenac
DB00711 Diethylcarbamazine
DB00861 Diflunisal
DB00154 Dihomo-gamma-linolenic acid
DB01075 Diphenhydramine
DB00470 Dronabinol
DB00216 Eletriptan
DB00402 Eszopiclone
DB00749 Etodolac
DB00773 Etoposide
DB00573 Fenoprofen
DB02266 Flufenamic Acid
DB00712 Flurbiprofen
DB03753 Flurbiprofen Methyl Ester
DB01355 Hexobarbital
DB00327 Hydromorphone
DB01892 Hyperforin
DB01050 Ibuprofen
DB00159 Icosapent
DB01181 Ifosfamide
DB00619 Imatinib
DB00328 Indomethacin
DB01029 Irbesartan
DB01221 Ketamine
DB06738 Ketobemidone
DB01009 Ketoprofen
DB00465 Ketorolac
DB06725 Lornoxicam
DB01283 Lumiracoxib
DB01397 Magnesium salicylate
DB00939 Meclofenamic acid
DB00784 Mefenamic acid
DB00814 Meloxicam
DB00244 Mesalazine
DB04817 Metamizole
DB00350 Minoxidil
DB00471 Montelukast
DB00461 Nabumetone
DB00788 Naproxen
DB00731 Nateglinide
DB05822 NCX 4016
DB06802 Nepafenac
DB04552 Niflumic Acid
DB00540 Nortriptyline
DB01837 O-acetyl-L-serine
DB00991 Oxaprozin
DB03752 P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid
DB03783 Phenacetin
DB00812 Phenylbutazone
DB01132 Pioglitazone
DB00554 Piroxicam
DB02110 Protoporphyrin Ix Containing Co
DB02709 Resveratrol
DB00533 Rofecoxib
DB00412 Rosiglitazone
DB00936 Salicylic acid
DB01399 Salsalate
DB01015 Sulfamethoxazole
DB00795 Sulfasalazine
DB00605 Sulindac
DB00870 Suprofen
DB00469 Tenoxicam
DB00857 Terbinafine
DB01041 Thalidomide
DB01600 Tiaprofenic acid
DB00500 Tolmetin
DB00214 Torasemide
DB05109 Trabectedin
DB08814 Triflusal
DB01401 Trisalicylate-choline
DB00313 Valproic Acid
DB00582 Voriconazole
DB00549 Zafirlukast
DB06737 Zaltoprofen
DB00744 Zileuton
DB00425 Zolpidem
DB01198 Zopiclone

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1375

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PTGS1

Domain mapping of disease mutations (DMDM)

More...DMDMi		317373262

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Add BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002386824 – 599Prostaglandin G/H synthase 1Add BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi35 ↔ 46By similarity
Disulfide bondi36 ↔ 158By similarity
Disulfide bondi40 ↔ 56By similarity
Disulfide bondi58 ↔ 68By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi568 ↔ 574By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P23219

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P23219

MaxQB - The MaxQuant DataBase

More...MaxQBi		P23219

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P23219

PeptideAtlas

More...PeptideAtlasi		P23219

PRoteomics IDEntifications database

More...PRIDEi		P23219

ProteomicsDB human proteome resource

More...ProteomicsDBi		4239
54063 [P23219-1]
54064 [P23219-2]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1648

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P23219

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P23219

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000095303 Expressed in 210 organ(s), highest expression level in fundus of stomach

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P23219 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P23219 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB020315
HPA002834

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111714, 7 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P23219

Protein interaction database and analysis system

More...IntActi		P23219, 3 interactors

Molecular INTeraction database

More...MINTi		P23219

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000354612

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P23219

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P23219

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 69EGF-likePROSITE-ProRule annotationAdd BLAST39

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the prostaglandin G/H synthase family.Curated

Keywords - Domaini

EGF-like domain, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2408 Eukaryota
ENOG410XPZ3 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000010743

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000013149

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P23219

KEGG Orthology (KO)

More...KOi		K00509

Identification of Orthologs from Complete Genome Data

More...OMAi		MPDSFKV

Database of Orthologous Groups

More...OrthoDBi		324380at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P23219

TreeFam database of animal gene trees

More...TreeFami		TF329675

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.640.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029580 COX-1
IPR000742 EGF-like_dom
IPR019791 Haem_peroxidase_animal
IPR010255 Haem_peroxidase_sf
IPR037120 Haem_peroxidase_sf_animal

The PANTHER Classification System

More...PANTHERi		PTHR11903:SF6 PTHR11903:SF6, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03098 An_peroxidase, 1 hit
PF00008 EGF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00457 ANPEROXIDASE

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48113 SSF48113, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50026 EGF_3, 1 hit
PS50292 PEROXIDASE_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P23219-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRSLLLWFL LFLLLLPPLP VLLADPGAPT PVNPCCYYPC QHQGICVRFG 
        60         70         80         90        100
LDRYQCDCTR TGYSGPNCTI PGLWTWLRNS LRPSPSFTHF LLTHGRWFWE 
       110        120        130        140        150
FVNATFIREM LMRLVLTVRS NLIPSPPTYN SAHDYISWES FSNVSYYTRI 
       160        170        180        190        200
LPSVPKDCPT PMGTKGKKQL PDAQLLARRF LLRRKFIPDP QGTNLMFAFF 
       210        220        230        240        250
AQHFTHQFFK TSGKMGPGFT KALGHGVDLG HIYGDNLERQ YQLRLFKDGK 
       260        270        280        290        300
LKYQVLDGEM YPPSVEEAPV LMHYPRGIPP QSQMAVGQEV FGLLPGLMLY 
       310        320        330        340        350
ATLWLREHNR VCDLLKAEHP TWGDEQLFQT TRLILIGETI KIVIEEYVQQ 
       360        370        380        390        400
LSGYFLQLKF DPELLFGVQF QYRNRIAMEF NHLYHWHPLM PDSFKVGSQE 
       410        420        430        440        450
YSYEQFLFNT SMLVDYGVEA LVDAFSRQIA GRIGGGRNMD HHILHVAVDV 
       460        470        480        490        500
IRESREMRLQ PFNEYRKRFG MKPYTSFQEL VGEKEMAAEL EELYGDIDAL 
       510        520        530        540        550
EFYPGLLLEK CHPNSIFGES MIEIGAPFSL KGLLGNPICS PEYWKPSTFG 
       560        570        580        590 
GEVGFNIVKT ATLKKLVCLN TKTCPYVSFR VPDASQDDGP AVERPSTEL
Length:599
Mass (Da):68,686
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1F4F734BCD00346D
GO
Isoform 2 (identifier: P23219-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     396-432: Missing.

Show »
Length:562
Mass (Da):64,513
Checksum:i7AB78D6FD94F5FF1
GO
Isoform 3 (identifier: P23219-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPV → MRKPRLM
     396-432: Missing.

Show »
Length:537
Mass (Da):61,930
Checksum:i9AD6A32F6FE7CF05
GO
Isoform 4 (identifier: P23219-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-109: Missing.

Note: No experimental confirmation available.
Show »
Length:490
Mass (Da):56,085
Checksum:i8C340B40B682E98C
GO
Isoform 5 (identifier: P23219-5) [UniParc]FASTAAdd to basket
Also known as: 1b3

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSR → MSRECDPGARWGIFLASGGALNARLSPSSLSSAG

Show »
Length:630
Mass (Da):71,717
Checksum:iB70763422AC0C249
GO
Isoform 6 (identifier: P23219-6) [UniParc]FASTAAdd to basket
Also known as: 1b2

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSR → MSRECDPGARWGIFLASWWSLECQLSPSSLSSAG

Show »
Length:630
Mass (Da):72,010
Checksum:i7A7080D69D5583C1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X296A0A087X296_HUMAN
Prostaglandin G/H synthase 1
PTGS1
551Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6RJD6X6RJD6_HUMAN
Prostaglandin G/H synthase 1
PTGS1
171Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YDM0A0A2R8YDM0_HUMAN
Prostaglandin G/H synthase 1
PTGS1
402Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6S0A0A2R8Y6S0_HUMAN
Prostaglandin G/H synthase 1
PTGS1
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti12F → L in AAA36439 (PubMed:2512924).Curated1
Sequence conflicti113R → L in AAA36439 (PubMed:2512924).Curated1
Sequence conflicti378M → T in AAA36439 (PubMed:2512924).Curated1
Sequence conflicti423D → G in BAG65237 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0134518W → R9 PublicationsCorresponds to variant dbSNP:rs1236913Ensembl.1
Natural variantiVAR_01345217P → L2 PublicationsCorresponds to variant dbSNP:rs3842787Ensembl.1
Natural variantiVAR_01916153R → H1 PublicationCorresponds to variant dbSNP:rs3842789Ensembl.1
Natural variantiVAR_019162149R → L1 PublicationCorresponds to variant dbSNP:rs10306140Ensembl.1
Natural variantiVAR_056663185K → T. Corresponds to variant dbSNP:rs3842792Ensembl.1
Natural variantiVAR_019163237L → M2 PublicationsCorresponds to variant dbSNP:rs5789Ensembl.1
Natural variantiVAR_056664341K → R. Corresponds to variant dbSNP:rs3842799Ensembl.1
Natural variantiVAR_013453359K → R. Corresponds to variant dbSNP:rs5791Ensembl.1
Natural variantiVAR_013454443I → V. Corresponds to variant dbSNP:rs5792Ensembl.1
Natural variantiVAR_028017481V → I1 PublicationCorresponds to variant dbSNP:rs5794Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0469321 – 109Missing in isoform 4. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_0539361 – 32MSRSL…APTPV → MRKPRLM in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0548621 – 3MSR → MSRECDPGARWGIFLASGGA LNARLSPSSLSSAG in isoform 5. 1 Publication3
Alternative sequenceiVSP_0548631 – 3MSR → MSRECDPGARWGIFLASWWS LECQLSPSSLSSAG in isoform 6. 1 Publication3
Alternative sequenceiVSP_004673396 – 432Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M31822
, M31812, M31813, M31814, M31815, M31816, M31817, M31818, M31819, M31820, M31821 Genomic DNA Translation: AAA36439.1
M59979 mRNA Translation: AAA03630.1
S78220 mRNA Translation: AAB21215.1
S36219 mRNA Translation: AAB22216.1
S36271 mRNA Translation: AAB22217.1
DQ180741 mRNA Translation: ABA60098.1
DQ180742 mRNA Translation: ABA60099.1
AF440204 Genomic DNA Translation: AAL33601.1
AK290022 mRNA Translation: BAF82711.1
AK295221 mRNA Translation: BAG58214.1
AK304403 mRNA Translation: BAG65237.1
AY449688 Genomic DNA Translation: AAR08907.1
AL162424 Genomic DNA No translation available.
AL359636 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87530.1
BC029840 mRNA Translation: AAH29840.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS59520.1 [P23219-3]
CCDS59521.1 [P23219-4]
CCDS6842.1 [P23219-1]
CCDS6843.1 [P23219-2]

Protein sequence database of the Protein Information Resource

More...PIRi		JH0259

NCBI Reference Sequences

More...RefSeqi		NP_000953.2, NM_000962.3 [P23219-1]
NP_001258094.1, NM_001271165.1 [P23219-4]
NP_001258095.1, NM_001271166.1
NP_001258297.1, NM_001271368.1 [P23219-3]
NP_542158.1, NM_080591.2 [P23219-2]
XP_011517178.1, XM_011518876.2 [P23219-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000223423; ENSP00000223423; ENSG00000095303 [P23219-2]
ENST00000362012; ENSP00000354612; ENSG00000095303 [P23219-1]
ENST00000373698; ENSP00000362802; ENSG00000095303 [P23219-4]
ENST00000540753; ENSP00000437709; ENSG00000095303 [P23219-3]
ENST00000614910; ENSP00000484800; ENSG00000095303 [P23219-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5742

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5742

UCSC genome browser

More...UCSCi		uc004bmf.3 human [P23219-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31822
, M31812, M31813, M31814, M31815, M31816, M31817, M31818, M31819, M31820, M31821 Genomic DNA Translation: AAA36439.1
M59979 mRNA Translation: AAA03630.1
S78220 mRNA Translation: AAB21215.1
S36219 mRNA Translation: AAB22216.1
S36271 mRNA Translation: AAB22217.1
DQ180741 mRNA Translation: ABA60098.1
DQ180742 mRNA Translation: ABA60099.1
AF440204 Genomic DNA Translation: AAL33601.1
AK290022 mRNA Translation: BAF82711.1
AK295221 mRNA Translation: BAG58214.1
AK304403 mRNA Translation: BAG65237.1
AY449688 Genomic DNA Translation: AAR08907.1
AL162424 Genomic DNA No translation available.
AL359636 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87530.1
BC029840 mRNA Translation: AAH29840.1
CCDSiCCDS59520.1 [P23219-3]
CCDS59521.1 [P23219-4]
CCDS6842.1 [P23219-1]
CCDS6843.1 [P23219-2]
PIRiJH0259
RefSeqiNP_000953.2, NM_000962.3 [P23219-1]
NP_001258094.1, NM_001271165.1 [P23219-4]
NP_001258095.1, NM_001271166.1
NP_001258297.1, NM_001271368.1 [P23219-3]
NP_542158.1, NM_080591.2 [P23219-2]
XP_011517178.1, XM_011518876.2 [P23219-4]

3D structure databases

SMRiP23219
ModBaseiSearch...

Protein-protein interaction databases

BioGridi111714, 7 interactors
CORUMiP23219
IntActiP23219, 3 interactors
MINTiP23219
STRINGi9606.ENSP00000354612

Chemistry databases

BindingDBiP23219
ChEMBLiCHEMBL221
DrugBankiDB02773 (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid
DB07983 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID
DB07981 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1R)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB07984 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1S)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB02198 2-Bromoacetyl Group
DB06736 Aceclofenac
DB00316 Acetaminophen
DB03667 Acetic Acid Salicyloyl-Amino-Ester
DB00945 Acetylsalicylic acid
DB01435 Antipyrine
DB01419 Antrafenine
DB04557 Arachidonic Acid
DB01014 Balsalazide
DB02379 Beta-D-Glucose
DB00963 Bromfenac
DB00796 Candesartan
DB00821 Carprofen
DB01136 Carvedilol
DB00672 Chlorpropamide
DB00250 Dapsone
DB00035 Desmopressin
DB00829 Diazepam
DB00586 Diclofenac
DB00711 Diethylcarbamazine
DB00861 Diflunisal
DB00154 Dihomo-gamma-linolenic acid
DB01075 Diphenhydramine
DB00470 Dronabinol
DB00216 Eletriptan
DB00402 Eszopiclone
DB00749 Etodolac
DB00773 Etoposide
DB00573 Fenoprofen
DB02266 Flufenamic Acid
DB00712 Flurbiprofen
DB03753 Flurbiprofen Methyl Ester
DB01355 Hexobarbital
DB00327 Hydromorphone
DB01892 Hyperforin
DB01050 Ibuprofen
DB00159 Icosapent
DB01181 Ifosfamide
DB00619 Imatinib
DB00328 Indomethacin
DB01029 Irbesartan
DB01221 Ketamine
DB06738 Ketobemidone
DB01009 Ketoprofen
DB00465 Ketorolac
DB06725 Lornoxicam
DB01283 Lumiracoxib
DB01397 Magnesium salicylate
DB00939 Meclofenamic acid
DB00784 Mefenamic acid
DB00814 Meloxicam
DB00244 Mesalazine
DB04817 Metamizole
DB00350 Minoxidil
DB00471 Montelukast
DB00461 Nabumetone
DB00788 Naproxen
DB00731 Nateglinide
DB05822 NCX 4016
DB06802 Nepafenac
DB04552 Niflumic Acid
DB00540 Nortriptyline
DB01837 O-acetyl-L-serine
DB00991 Oxaprozin
DB03752 P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid
DB03783 Phenacetin
DB00812 Phenylbutazone
DB01132 Pioglitazone
DB00554 Piroxicam
DB02110 Protoporphyrin Ix Containing Co
DB02709 Resveratrol
DB00533 Rofecoxib
DB00412 Rosiglitazone
DB00936 Salicylic acid
DB01399 Salsalate
DB01015 Sulfamethoxazole
DB00795 Sulfasalazine
DB00605 Sulindac
DB00870 Suprofen
DB00469 Tenoxicam
DB00857 Terbinafine
DB01041 Thalidomide
DB01600 Tiaprofenic acid
DB00500 Tolmetin
DB00214 Torasemide
DB05109 Trabectedin
DB08814 Triflusal
DB01401 Trisalicylate-choline
DB00313 Valproic Acid
DB00582 Voriconazole
DB00549 Zafirlukast
DB06737 Zaltoprofen
DB00744 Zileuton
DB00425 Zolpidem
DB01198 Zopiclone
GuidetoPHARMACOLOGYi1375
SwissLipidsiSLP:000001103

Protein family/group databases

MoonDBiP23219 Curated
PeroxiBasei3320 HsPGHS01

PTM databases

GlyConnecti1648
iPTMnetiP23219
PhosphoSitePlusiP23219

Polymorphism and mutation databases

BioMutaiPTGS1
DMDMi317373262

Proteomic databases

EPDiP23219
jPOSTiP23219
MaxQBiP23219
PaxDbiP23219
PeptideAtlasiP23219
PRIDEiP23219
ProteomicsDBi4239
54063 [P23219-1]
54064 [P23219-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		5742
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000223423; ENSP00000223423; ENSG00000095303 [P23219-2]
ENST00000362012; ENSP00000354612; ENSG00000095303 [P23219-1]
ENST00000373698; ENSP00000362802; ENSG00000095303 [P23219-4]
ENST00000540753; ENSP00000437709; ENSG00000095303 [P23219-3]
ENST00000614910; ENSP00000484800; ENSG00000095303 [P23219-1]
GeneIDi5742
KEGGihsa:5742
UCSCiuc004bmf.3 human [P23219-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5742
DisGeNETi5742

GeneCards: human genes, protein and diseases

More...GeneCardsi		PTGS1
HGNCiHGNC:9604 PTGS1
HPAiCAB020315
HPA002834
MIMi176805 gene
neXtProtiNX_P23219
OpenTargetsiENSG00000095303
PharmGKBiPA24346

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2408 Eukaryota
ENOG410XPZ3 LUCA
GeneTreeiENSGT00390000010743
HOGENOMiHOG000013149
InParanoidiP23219
KOiK00509
OMAiMPDSFKV
OrthoDBi324380at2759
PhylomeDBiP23219
TreeFamiTF329675

Enzyme and pathway databases

UniPathwayiUPA00662
BioCyciMetaCyc:HS01815-MONOMER
BRENDAi1.14.99.1 2681
ReactomeiR-HSA-140180 COX reactions
R-HSA-2162123 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
SABIO-RKiP23219
SIGNORiP23219

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PTGS1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PTGS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5742

Protein Ontology

More...PROi		PR:P23219

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000095303 Expressed in 210 organ(s), highest expression level in fundus of stomach
ExpressionAtlasiP23219 baseline and differential
GenevisibleiP23219 HS

Family and domain databases

Gene3Di1.10.640.10, 1 hit
InterProiView protein in InterPro
IPR029580 COX-1
IPR000742 EGF-like_dom
IPR019791 Haem_peroxidase_animal
IPR010255 Haem_peroxidase_sf
IPR037120 Haem_peroxidase_sf_animal
PANTHERiPTHR11903:SF6 PTHR11903:SF6, 1 hit
PfamiView protein in Pfam
PF03098 An_peroxidase, 1 hit
PF00008 EGF, 1 hit
PRINTSiPR00457 ANPEROXIDASE
SUPFAMiSSF48113 SSF48113, 1 hit
PROSITEiView protein in PROSITE
PS50026 EGF_3, 1 hit
PS50292 PEROXIDASE_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPGH1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P23219
Secondary accession number(s): A8K1V7
, B4DHQ2, B4E2S5, Q15122, Q3HY28, Q3HY29, Q5T7T6, Q5T7T7, Q5T7T8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: January 11, 2011
Last modified: July 31, 2019
This is version 207 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again