Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin G/H synthase 1

Gene

PTGS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.

Miscellaneous

The conversion of arachidonate to prostaglandin H2 is a 2 step reaction: a cyclooxygenase (COX) reaction which converts arachidonate to prostaglandin G2 (PGG2) and a peroxidase reaction in which PGG2 is reduced to prostaglandin H2 (PGH2). The cyclooxygenase reaction occurs in a hydrophobic channel in the core of the enzyme. The peroxidase reaction occurs at a heme-containing active site located near the protein surface. The nonsteroidal anti-inflammatory drugs (NSAIDs) binding site corresponds to the cyclooxygenase active site.
Conversion of arachidonate to prostaglandin H2 is mediated by 2 different isozymes: the constitutive PTGS1 and the inducible PTGS2. PGHS1 is expressed constitutively and generally produces prostanoids acutely in response to hormonal stimuli to fine-tune physiological processes requiring instantaneous, continuous regulation (e.g. hemostasis). PGHS2 is inducible and typically produces prostanoids that mediate responses to physiological stresses such as infection and inflammation.
PTGS1 and PTGS2 are the targets of nonsteroidal anti-inflammatory drugs (NSAIDs) including aspirin and ibuprofen. Aspirin is able to produce an irreversible inactivation of the enzyme through a serine acetylation. Inhibition of the PGHSs with NSAIDs acutely reduces inflammation, pain, and fever, and long-term use of these drugs reduces fatal thrombotic events, as well as the development of colon cancer and Alzheimer's disease. PTGS2 is the principal isozyme responsible for production of inflammatory prostaglandins. New generation PTGSs inhibitors strive to be selective for PTGS2, to avoid side effects such as gastrointestinal complications and ulceration.

Catalytic activityi

Arachidonate + AH2 + 2 O2 = prostaglandin H2 + A + H2O.

Cofactori

heme bBy similarityNote: Binds 1 heme b (iron(II)-protoporphyrin IX) group per subunit.By similarity

Pathwayi: prostaglandin biosynthesis

This protein is involved in the pathway prostaglandin biosynthesis, which is part of Lipid metabolism.
View all proteins of this organism that are known to be involved in the pathway prostaglandin biosynthesis and in Lipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei206Proton acceptorPROSITE-ProRule annotation1
Active sitei384For cyclooxygenase activityBy similarity1
Metal bindingi387Iron (heme axial ligand)PROSITE-ProRule annotation1
Sitei529Aspirin-acetylated serine1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDioxygenase, Oxidoreductase, Peroxidase
Biological processFatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS01815-MONOMER
BRENDAi1.14.99.1 2681
ReactomeiR-HSA-140180 COX reactions
R-HSA-2162123 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
SIGNORiP23219
UniPathwayi
UPA00662

Protein family/group databases

MoonDBiP23219 Curated
PeroxiBasei3320 HsPGHS01

Chemistry databases

SwissLipidsiSLP:000001103

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin G/H synthase 1 (EC:1.14.99.1)
Alternative name(s):
Cyclooxygenase-1
Short name:
COX-1
Prostaglandin H2 synthase 1
Short name:
PGH synthase 1
Short name:
PGHS-1
Short name:
PHS 1
Prostaglandin-endoperoxide synthase 1
Gene namesi
Name:PTGS1
Synonyms:COX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000095303.14
HGNCiHGNC:9604 PTGS1
MIMi176805 gene
neXtProtiNX_P23219

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi529S → N: Abolishes cyclooxygenase activity. 1 Publication1

Organism-specific databases

DisGeNETi5742
OpenTargetsiENSG00000095303
PharmGKBiPA24346

Chemistry databases

ChEMBLiCHEMBL221
DrugBankiDB02773 (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid
DB07983 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID
DB07981 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1R)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB07984 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1S)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB02198 2-Bromoacetyl Group
DB06736 Aceclofenac
DB00316 Acetaminophen
DB03667 Acetic Acid Salicyloyl-Amino-Ester
DB00945 Acetylsalicylic acid
DB01435 Antipyrine
DB01419 Antrafenine
DB04557 Arachidonic Acid
DB01014 Balsalazide
DB02379 Beta-D-Glucose
DB00963 Bromfenac
DB00796 Candesartan
DB00821 Carprofen
DB01136 Carvedilol
DB00672 Chlorpropamide
DB00250 Dapsone
DB00035 Desmopressin
DB00829 Diazepam
DB00586 Diclofenac
DB00711 Diethylcarbamazine
DB00861 Diflunisal
DB00154 Dihomo-gamma-linolenic acid
DB01075 Diphenhydramine
DB00470 Dronabinol
DB00216 Eletriptan
DB00402 Eszopiclone
DB00749 Etodolac
DB00773 Etoposide
DB00573 Fenoprofen
DB02266 Flufenamic Acid
DB00712 Flurbiprofen
DB03753 Flurbiprofen Methyl Ester
DB01355 Hexobarbital
DB00327 Hydromorphone
DB01892 Hyperforin
DB01050 Ibuprofen
DB00159 Icosapent
DB01181 Ifosfamide
DB00619 Imatinib
DB00328 Indomethacin
DB01029 Irbesartan
DB01221 Ketamine
DB06738 Ketobemidone
DB01009 Ketoprofen
DB00465 Ketorolac
DB06725 Lornoxicam
DB01283 Lumiracoxib
DB01397 Magnesium salicylate
DB00939 Meclofenamic acid
DB00784 Mefenamic acid
DB00814 Meloxicam
DB00244 Mesalazine
DB04817 Metamizole
DB00350 Minoxidil
DB00471 Montelukast
DB00461 Nabumetone
DB00788 Naproxen
DB00731 Nateglinide
DB05822 NCX 4016
DB06802 Nepafenac
DB04552 Niflumic Acid
DB00540 Nortriptyline
DB01837 O-acetyl-L-serine
DB00991 Oxaprozin
DB03752 P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid
DB03783 Phenacetin
DB00812 Phenylbutazone
DB01132 Pioglitazone
DB00554 Piroxicam
DB02110 Protoporphyrin Ix Containing Co
DB02709 Resveratrol
DB00533 Rofecoxib
DB00412 Rosiglitazone
DB00936 Salicylic acid
DB01399 Salsalate
DB01015 Sulfamethoxazole
DB00795 Sulfasalazine
DB00605 Sulindac
DB00870 Suprofen
DB00469 Tenoxicam
DB00857 Terbinafine
DB01041 Thalidomide
DB01600 Tiaprofenic acid
DB00500 Tolmetin
DB00214 Torasemide
DB05109 Trabectedin
DB08814 Triflusal
DB01401 Trisalicylate-choline
DB00313 Valproic Acid
DB00582 Voriconazole
DB00549 Zafirlukast
DB06737 Zaltoprofen
DB00744 Zileuton
DB00425 Zolpidem
DB01198 Zopiclone
GuidetoPHARMACOLOGYi1375

Polymorphism and mutation databases

DMDMi317373262

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Add BLAST23
ChainiPRO_000002386824 – 599Prostaglandin G/H synthase 1Add BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi35 ↔ 46By similarity
Disulfide bondi36 ↔ 158By similarity
Disulfide bondi40 ↔ 56By similarity
Disulfide bondi58 ↔ 68By similarity
Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi568 ↔ 574By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiP23219
MaxQBiP23219
PaxDbiP23219
PeptideAtlasiP23219
PRIDEiP23219
ProteomicsDBi54063
54064 [P23219-2]

PTM databases

GlyConnecti1648
iPTMnetiP23219
PhosphoSitePlusiP23219

Expressioni

Gene expression databases

BgeeiENSG00000095303 Expressed in 210 organ(s), highest expression level in fundus of stomach
CleanExiHS_PTGS1
ExpressionAtlasiP23219 baseline and differential
GenevisibleiP23219 HS

Organism-specific databases

HPAiCAB020315
HPA002834

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

BioGridi111714, 6 interactors
CORUMiP23219
IntActiP23219, 3 interactors
MINTiP23219
STRINGi9606.ENSP00000354612

Chemistry databases

BindingDBiP23219

Structurei

3D structure databases

ProteinModelPortaliP23219
SMRiP23219
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 69EGF-likePROSITE-ProRule annotationAdd BLAST39

Sequence similaritiesi

Belongs to the prostaglandin G/H synthase family.Curated

Keywords - Domaini

EGF-like domain, Signal

Phylogenomic databases

eggNOGiKOG2408 Eukaryota
ENOG410XPZ3 LUCA
GeneTreeiENSGT00390000010743
HOGENOMiHOG000013149
HOVERGENiHBG000366
InParanoidiP23219
KOiK00509
OMAiMPDSFKV
OrthoDBiEOG091G03CD
PhylomeDBiP23219
TreeFamiTF329675

Family and domain databases

Gene3Di1.10.640.10, 1 hit
InterProiView protein in InterPro
IPR029580 COX-1
IPR000742 EGF-like_dom
IPR010255 Haem_peroxidase
IPR019791 Haem_peroxidase_animal
IPR037120 Haem_peroxidase_sf
PANTHERiPTHR11903:SF6 PTHR11903:SF6, 1 hit
PfamiView protein in Pfam
PF03098 An_peroxidase, 1 hit
PF00008 EGF, 1 hit
PRINTSiPR00457 ANPEROXIDASE
SUPFAMiSSF48113 SSF48113, 1 hit
PROSITEiView protein in PROSITE
PS50026 EGF_3, 1 hit
PS50292 PEROXIDASE_3, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P23219-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRSLLLWFL LFLLLLPPLP VLLADPGAPT PVNPCCYYPC QHQGICVRFG
60 70 80 90 100
LDRYQCDCTR TGYSGPNCTI PGLWTWLRNS LRPSPSFTHF LLTHGRWFWE
110 120 130 140 150
FVNATFIREM LMRLVLTVRS NLIPSPPTYN SAHDYISWES FSNVSYYTRI
160 170 180 190 200
LPSVPKDCPT PMGTKGKKQL PDAQLLARRF LLRRKFIPDP QGTNLMFAFF
210 220 230 240 250
AQHFTHQFFK TSGKMGPGFT KALGHGVDLG HIYGDNLERQ YQLRLFKDGK
260 270 280 290 300
LKYQVLDGEM YPPSVEEAPV LMHYPRGIPP QSQMAVGQEV FGLLPGLMLY
310 320 330 340 350
ATLWLREHNR VCDLLKAEHP TWGDEQLFQT TRLILIGETI KIVIEEYVQQ
360 370 380 390 400
LSGYFLQLKF DPELLFGVQF QYRNRIAMEF NHLYHWHPLM PDSFKVGSQE
410 420 430 440 450
YSYEQFLFNT SMLVDYGVEA LVDAFSRQIA GRIGGGRNMD HHILHVAVDV
460 470 480 490 500
IRESREMRLQ PFNEYRKRFG MKPYTSFQEL VGEKEMAAEL EELYGDIDAL
510 520 530 540 550
EFYPGLLLEK CHPNSIFGES MIEIGAPFSL KGLLGNPICS PEYWKPSTFG
560 570 580 590
GEVGFNIVKT ATLKKLVCLN TKTCPYVSFR VPDASQDDGP AVERPSTEL
Length:599
Mass (Da):68,686
Last modified:January 11, 2011 - v2
Checksum:i1F4F734BCD00346D
GO
Isoform 2 (identifier: P23219-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     396-432: Missing.

Show »
Length:562
Mass (Da):64,513
Checksum:i7AB78D6FD94F5FF1
GO
Isoform 3 (identifier: P23219-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPV → MRKPRLM
     396-432: Missing.

Show »
Length:537
Mass (Da):61,930
Checksum:i9AD6A32F6FE7CF05
GO
Isoform 4 (identifier: P23219-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-109: Missing.

Note: No experimental confirmation available.
Show »
Length:490
Mass (Da):56,085
Checksum:i8C340B40B682E98C
GO
Isoform 5 (identifier: P23219-5) [UniParc]FASTAAdd to basket
Also known as: 1b3

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSR → MSRECDPGARWGIFLASGGALNARLSPSSLSSAG

Show »
Length:630
Mass (Da):71,717
Checksum:iB70763422AC0C249
GO
Isoform 6 (identifier: P23219-6) [UniParc]FASTAAdd to basket
Also known as: 1b2

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSR → MSRECDPGARWGIFLASWWSLECQLSPSSLSSAG

Show »
Length:630
Mass (Da):72,010
Checksum:i7A7080D69D5583C1
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X296A0A087X296_HUMAN
Prostaglandin G/H synthase 1
PTGS1
551Annotation score:
X6RJD6X6RJD6_HUMAN
Prostaglandin G/H synthase 1
PTGS1
171Annotation score:
A0A2R8YDM0A0A2R8YDM0_HUMAN
Prostaglandin G/H synthase 1
PTGS1
402Annotation score:
A0A2R8Y6S0A0A2R8Y6S0_HUMAN
Prostaglandin G/H synthase 1
PTGS1
41Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12F → L in AAA36439 (PubMed:2512924).Curated1
Sequence conflicti113R → L in AAA36439 (PubMed:2512924).Curated1
Sequence conflicti378M → T in AAA36439 (PubMed:2512924).Curated1
Sequence conflicti423D → G in BAG65237 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0134518W → R9 PublicationsCorresponds to variant dbSNP:rs1236913Ensembl.1
Natural variantiVAR_01345217P → L2 PublicationsCorresponds to variant dbSNP:rs3842787Ensembl.1
Natural variantiVAR_01916153R → H1 PublicationCorresponds to variant dbSNP:rs3842789Ensembl.1
Natural variantiVAR_019162149R → L1 PublicationCorresponds to variant dbSNP:rs10306140Ensembl.1
Natural variantiVAR_056663185K → T. Corresponds to variant dbSNP:rs3842792Ensembl.1
Natural variantiVAR_019163237L → M2 PublicationsCorresponds to variant dbSNP:rs5789Ensembl.1
Natural variantiVAR_056664341K → R. Corresponds to variant dbSNP:rs3842799Ensembl.1
Natural variantiVAR_013453359K → R. Corresponds to variant dbSNP:rs5791Ensembl.1
Natural variantiVAR_013454443I → V. Corresponds to variant dbSNP:rs5792Ensembl.1
Natural variantiVAR_028017481V → I1 PublicationCorresponds to variant dbSNP:rs5794Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0469321 – 109Missing in isoform 4. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_0539361 – 32MSRSL…APTPV → MRKPRLM in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0548621 – 3MSR → MSRECDPGARWGIFLASGGA LNARLSPSSLSSAG in isoform 5. 1 Publication3
Alternative sequenceiVSP_0548631 – 3MSR → MSRECDPGARWGIFLASWWS LECQLSPSSLSSAG in isoform 6. 1 Publication3
Alternative sequenceiVSP_004673396 – 432Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31822
, M31812, M31813, M31814, M31815, M31816, M31817, M31818, M31819, M31820, M31821 Genomic DNA Translation: AAA36439.1
M59979 mRNA Translation: AAA03630.1
S78220 mRNA Translation: AAB21215.1
S36219 mRNA Translation: AAB22216.1
S36271 mRNA Translation: AAB22217.1
DQ180741 mRNA Translation: ABA60098.1
DQ180742 mRNA Translation: ABA60099.1
AF440204 Genomic DNA Translation: AAL33601.1
AK290022 mRNA Translation: BAF82711.1
AK295221 mRNA Translation: BAG58214.1
AK304403 mRNA Translation: BAG65237.1
AY449688 Genomic DNA Translation: AAR08907.1
AL162424 Genomic DNA No translation available.
AL359636 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87530.1
BC029840 mRNA Translation: AAH29840.1
CCDSiCCDS59520.1 [P23219-3]
CCDS59521.1 [P23219-4]
CCDS6842.1 [P23219-1]
CCDS6843.1 [P23219-2]
PIRiJH0259
RefSeqiNP_000953.2, NM_000962.3 [P23219-1]
NP_001258094.1, NM_001271165.1 [P23219-4]
NP_001258095.1, NM_001271166.1
NP_001258297.1, NM_001271368.1 [P23219-3]
NP_542158.1, NM_080591.2 [P23219-2]
XP_011517178.1, XM_011518876.2 [P23219-4]
UniGeneiHs.201978

Genome annotation databases

EnsembliENST00000223423; ENSP00000223423; ENSG00000095303 [P23219-2]
ENST00000362012; ENSP00000354612; ENSG00000095303 [P23219-1]
ENST00000373698; ENSP00000362802; ENSG00000095303 [P23219-4]
ENST00000540753; ENSP00000437709; ENSG00000095303 [P23219-3]
ENST00000614910; ENSP00000484800; ENSG00000095303 [P23219-1]
GeneIDi5742
KEGGihsa:5742
UCSCiuc004bmf.3 human [P23219-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31822
, M31812, M31813, M31814, M31815, M31816, M31817, M31818, M31819, M31820, M31821 Genomic DNA Translation: AAA36439.1
M59979 mRNA Translation: AAA03630.1
S78220 mRNA Translation: AAB21215.1
S36219 mRNA Translation: AAB22216.1
S36271 mRNA Translation: AAB22217.1
DQ180741 mRNA Translation: ABA60098.1
DQ180742 mRNA Translation: ABA60099.1
AF440204 Genomic DNA Translation: AAL33601.1
AK290022 mRNA Translation: BAF82711.1
AK295221 mRNA Translation: BAG58214.1
AK304403 mRNA Translation: BAG65237.1
AY449688 Genomic DNA Translation: AAR08907.1
AL162424 Genomic DNA No translation available.
AL359636 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87530.1
BC029840 mRNA Translation: AAH29840.1
CCDSiCCDS59520.1 [P23219-3]
CCDS59521.1 [P23219-4]
CCDS6842.1 [P23219-1]
CCDS6843.1 [P23219-2]
PIRiJH0259
RefSeqiNP_000953.2, NM_000962.3 [P23219-1]
NP_001258094.1, NM_001271165.1 [P23219-4]
NP_001258095.1, NM_001271166.1
NP_001258297.1, NM_001271368.1 [P23219-3]
NP_542158.1, NM_080591.2 [P23219-2]
XP_011517178.1, XM_011518876.2 [P23219-4]
UniGeneiHs.201978

3D structure databases

ProteinModelPortaliP23219
SMRiP23219
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111714, 6 interactors
CORUMiP23219
IntActiP23219, 3 interactors
MINTiP23219
STRINGi9606.ENSP00000354612

Chemistry databases

BindingDBiP23219
ChEMBLiCHEMBL221
DrugBankiDB02773 (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid
DB07983 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID
DB07981 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1R)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB07984 2-[1-(4-CHLOROBENZOYL)-5-METHOXY-2-METHYL-1H-INDOL-3-YL]-N-[(1S)-1-(HYDROXYMETHYL)PROPYL]ACETAMIDE
DB02198 2-Bromoacetyl Group
DB06736 Aceclofenac
DB00316 Acetaminophen
DB03667 Acetic Acid Salicyloyl-Amino-Ester
DB00945 Acetylsalicylic acid
DB01435 Antipyrine
DB01419 Antrafenine
DB04557 Arachidonic Acid
DB01014 Balsalazide
DB02379 Beta-D-Glucose
DB00963 Bromfenac
DB00796 Candesartan
DB00821 Carprofen
DB01136 Carvedilol
DB00672 Chlorpropamide
DB00250 Dapsone
DB00035 Desmopressin
DB00829 Diazepam
DB00586 Diclofenac
DB00711 Diethylcarbamazine
DB00861 Diflunisal
DB00154 Dihomo-gamma-linolenic acid
DB01075 Diphenhydramine
DB00470 Dronabinol
DB00216 Eletriptan
DB00402 Eszopiclone
DB00749 Etodolac
DB00773 Etoposide
DB00573 Fenoprofen
DB02266 Flufenamic Acid
DB00712 Flurbiprofen
DB03753 Flurbiprofen Methyl Ester
DB01355 Hexobarbital
DB00327 Hydromorphone
DB01892 Hyperforin
DB01050 Ibuprofen
DB00159 Icosapent
DB01181 Ifosfamide
DB00619 Imatinib
DB00328 Indomethacin
DB01029 Irbesartan
DB01221 Ketamine
DB06738 Ketobemidone
DB01009 Ketoprofen
DB00465 Ketorolac
DB06725 Lornoxicam
DB01283 Lumiracoxib
DB01397 Magnesium salicylate
DB00939 Meclofenamic acid
DB00784 Mefenamic acid
DB00814 Meloxicam
DB00244 Mesalazine
DB04817 Metamizole
DB00350 Minoxidil
DB00471 Montelukast
DB00461 Nabumetone
DB00788 Naproxen
DB00731 Nateglinide
DB05822 NCX 4016
DB06802 Nepafenac
DB04552 Niflumic Acid
DB00540 Nortriptyline
DB01837 O-acetyl-L-serine
DB00991 Oxaprozin
DB03752 P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid
DB03783 Phenacetin
DB00812 Phenylbutazone
DB01132 Pioglitazone
DB00554 Piroxicam
DB02110 Protoporphyrin Ix Containing Co
DB02709 Resveratrol
DB00533 Rofecoxib
DB00412 Rosiglitazone
DB00936 Salicylic acid
DB01399 Salsalate
DB01015 Sulfamethoxazole
DB00795 Sulfasalazine
DB00605 Sulindac
DB00870 Suprofen
DB00469 Tenoxicam
DB00857 Terbinafine
DB01041 Thalidomide
DB01600 Tiaprofenic acid
DB00500 Tolmetin
DB00214 Torasemide
DB05109 Trabectedin
DB08814 Triflusal
DB01401 Trisalicylate-choline
DB00313 Valproic Acid
DB00582 Voriconazole
DB00549 Zafirlukast
DB06737 Zaltoprofen
DB00744 Zileuton
DB00425 Zolpidem
DB01198 Zopiclone
GuidetoPHARMACOLOGYi1375
SwissLipidsiSLP:000001103

Protein family/group databases

MoonDBiP23219 Curated
PeroxiBasei3320 HsPGHS01

PTM databases

GlyConnecti1648
iPTMnetiP23219
PhosphoSitePlusiP23219

Polymorphism and mutation databases

DMDMi317373262

Proteomic databases

EPDiP23219
MaxQBiP23219
PaxDbiP23219
PeptideAtlasiP23219
PRIDEiP23219
ProteomicsDBi54063
54064 [P23219-2]

Protocols and materials databases

DNASUi5742
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000223423; ENSP00000223423; ENSG00000095303 [P23219-2]
ENST00000362012; ENSP00000354612; ENSG00000095303 [P23219-1]
ENST00000373698; ENSP00000362802; ENSG00000095303 [P23219-4]
ENST00000540753; ENSP00000437709; ENSG00000095303 [P23219-3]
ENST00000614910; ENSP00000484800; ENSG00000095303 [P23219-1]
GeneIDi5742
KEGGihsa:5742
UCSCiuc004bmf.3 human [P23219-1]

Organism-specific databases

CTDi5742
DisGeNETi5742
EuPathDBiHostDB:ENSG00000095303.14
GeneCardsiPTGS1
HGNCiHGNC:9604 PTGS1
HPAiCAB020315
HPA002834
MIMi176805 gene
neXtProtiNX_P23219
OpenTargetsiENSG00000095303
PharmGKBiPA24346
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2408 Eukaryota
ENOG410XPZ3 LUCA
GeneTreeiENSGT00390000010743
HOGENOMiHOG000013149
HOVERGENiHBG000366
InParanoidiP23219
KOiK00509
OMAiMPDSFKV
OrthoDBiEOG091G03CD
PhylomeDBiP23219
TreeFamiTF329675

Enzyme and pathway databases

UniPathwayi
UPA00662

BioCyciMetaCyc:HS01815-MONOMER
BRENDAi1.14.99.1 2681
ReactomeiR-HSA-140180 COX reactions
R-HSA-2162123 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
SIGNORiP23219

Miscellaneous databases

ChiTaRSiPTGS1 human
GeneWikiiPTGS1
GenomeRNAii5742
PROiPR:P23219
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000095303 Expressed in 210 organ(s), highest expression level in fundus of stomach
CleanExiHS_PTGS1
ExpressionAtlasiP23219 baseline and differential
GenevisibleiP23219 HS

Family and domain databases

Gene3Di1.10.640.10, 1 hit
InterProiView protein in InterPro
IPR029580 COX-1
IPR000742 EGF-like_dom
IPR010255 Haem_peroxidase
IPR019791 Haem_peroxidase_animal
IPR037120 Haem_peroxidase_sf
PANTHERiPTHR11903:SF6 PTHR11903:SF6, 1 hit
PfamiView protein in Pfam
PF03098 An_peroxidase, 1 hit
PF00008 EGF, 1 hit
PRINTSiPR00457 ANPEROXIDASE
SUPFAMiSSF48113 SSF48113, 1 hit
PROSITEiView protein in PROSITE
PS50026 EGF_3, 1 hit
PS50292 PEROXIDASE_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPGH1_HUMAN
AccessioniPrimary (citable) accession number: P23219
Secondary accession number(s): A8K1V7
, B4DHQ2, B4E2S5, Q15122, Q3HY28, Q3HY29, Q5T7T6, Q5T7T7, Q5T7T8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: January 11, 2011
Last modified: November 7, 2018
This is version 201 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again