Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P23219 (PGH1_HUMAN)

Entry version 216 (02 Dec 2020)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Prostaglandin G/H synthase 1

Gene

PTGS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Dual cyclooxygenase and peroxidase in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate, with a particular role in the inflammatory response. The cyclooxygenase activity oxygenates arachidonate (AA, C20:4(n-6)) to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide PGH2, the precursor of all 2-series prostaglandins and thromboxanes. This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons (PubMed:7947975). Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells (Probable).2 Publications1 Publication

Miscellaneous

The conversion of arachidonate to prostaglandin H2 is a 2 step reaction: a cyclooxygenase (COX) reaction which converts arachidonate to prostaglandin G2 (PGG2) and a peroxidase reaction in which PGG2 is reduced to prostaglandin H2 (PGH2). The cyclooxygenase reaction occurs in a hydrophobic channel in the core of the enzyme. The peroxidase reaction occurs at a heme-containing active site located near the protein surface. The nonsteroidal anti-inflammatory drugs (NSAIDs) binding site corresponds to the cyclooxygenase active site.
Conversion of arachidonate to prostaglandin H2 is mediated by 2 different isozymes: the constitutive PTGS1 and the inducible PTGS2. PTGS1 is expressed constitutively and generally produces prostanoids acutely in response to hormonal stimuli to fine-tune physiological processes requiring instantaneous, continuous regulation (e.g. hemostasis). PTGS2 is inducible and typically produces prostanoids that mediate responses to physiological stresses such as infection and inflammation.
PTGS1 and PTGS2 are the targets of nonsteroidal anti-inflammatory drugs (NSAIDs) including aspirin and ibuprofen. Aspirin is able to produce an irreversible inactivation of the enzyme through a serine acetylation. Inhibition of the PGHSs with NSAIDs acutely reduces inflammation, pain, and fever, and long-term use of these drugs reduces fatal thrombotic events, as well as the development of colon cancer and Alzheimer's disease. PTGS2 is the principal isozyme responsible for production of inflammatory prostaglandins. New generation PTGSs inhibitors strive to be selective for PTGS2, to avoid side effects such as gastrointestinal complications and ulceration.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

heme bBy similarityNote: Binds 1 heme b (iron(II)-protoporphyrin IX) group per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

The cyclooxygenase activity is inhibited by nonsteroidal anti-inflammatory drugs (NSAIDs) including ibuprofen, flurbiprofen, ketoprofen, naproxen, flurbiprofen, anirolac, fenclofenac and diclofenac.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=5.1 µM for arachidonate1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: prostaglandin biosynthesis

    This protein is involved in the pathway prostaglandin biosynthesis, which is part of Lipid metabolism.1 Publication
    View all proteins of this organism that are known to be involved in the pathway prostaglandin biosynthesis and in Lipid metabolism.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei206Proton acceptorPROSITE-ProRule annotation1
    Active sitei384For cyclooxygenase activityBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi387Iron (heme axial ligand)PROSITE-ProRule annotation1
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei529Aspirin-acetylated serine1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionDioxygenase, Oxidoreductase, Peroxidase
    Biological processFatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism
    LigandHeme, Iron, Metal-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...    BioCyci    		MetaCyc:HS01815-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		1.14.99.1, 2681

    Pathway Commons web resource for biological pathway data

    More...    PathwayCommonsi    		P23219

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-140180, COX reactions
    R-HSA-2162123, Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...    SABIO-RKi    		P23219

    SIGNOR Signaling Network Open Resource

    More...    SIGNORi    		P23219

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...    UniPathwayi    		UPA00662

    Protein family/group databases

    MoonDB Database of extreme multifunctional and moonlighting proteins

    More...    MoonDBi    		P23219, Curated

    PeroxiBase, a peroxidase database

    More...    PeroxiBasei    		3320, HsPGHS01

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...    SwissLipidsi    		SLP:000001103

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Prostaglandin G/H synthase 1Curated (EC:1.14.99.11 Publication)
    Alternative name(s):
    Cyclooxygenase-11 Publication
    Short name:
    COX-11 Publication
    Prostaglandin H2 synthase 1
    Short name:
    PGH synthase 1
    Short name:
    PGHS-1
    Short name:
    PHS 1
    Prostaglandin-endoperoxide synthase 1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:PTGS1Imported
    Synonyms:COX11 Publication
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

    Organism-specific databases

    Eukaryotic Pathogen and Host Database Resources

    More...    EuPathDBi    		HostDB:ENSG00000095303.14

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:9604, PTGS1

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		176805, gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_P23219

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi529S → N: Abolishes cyclooxygenase activity. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		5742

    Open Targets

    More...    OpenTargetsi    		ENSG00000095303

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA24346

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...    Pharosi    		P23219, Tclin

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...    ChEMBLi    		CHEMBL221

    Drug and drug target database

    More...    DrugBanki    		DB02047, (+)-2-(4-biphenyl)propionic acid
    DB02773, (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid
    DB07983, 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID
    DB07981, 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1R)-1-(hydroxymethyl)propyl]acetamide
    DB07984, 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1S)-1-(hydroxymethyl)propyl]acetamide
    DB02198, 2-Bromoacetyl Group
    DB06736, Aceclofenac
    DB13783, Acemetacin
    DB00316, Acetaminophen
    DB03667, Acetic Acid Salicyloyl-Amino-Ester
    DB00945, Acetylsalicylic acid
    DB01435, Antipyrine
    DB01419, Antrafenine
    DB04557, Arachidonic Acid
    DB01014, Balsalazide
    DB13501, Bendazac
    DB02379, Beta-D-Glucose
    DB00963, Bromfenac
    DB13346, Bufexamac
    DB13919, Candesartan
    DB00796, Candesartan cilexetil
    DB09061, Cannabidiol
    DB00821, Carprofen
    DB00672, Chlorpropamide
    DB01401, Choline magnesium trisalicylate
    DB00250, Dapsone
    DB00035, Desmopressin
    DB09213, Dexibuprofen
    DB09214, Dexketoprofen
    DB00829, Diazepam
    DB00586, Diclofenac
    DB00711, Diethylcarbamazine
    DB00861, Diflunisal
    DB00154, Dihomo-gamma-linolenic acid
    DB01075, Diphenhydramine
    DB00470, Dronabinol
    DB09215, Droxicam
    DB00216, Eletriptan
    DB00749, Etodolac
    DB00773, Etoposide
    DB00573, Fenoprofen
    DB02266, Flufenamic acid
    DB00712, Flurbiprofen
    DB03753, Flurbiprofen Methyl Ester
    DB11323, Glycol salicylate
    DB01355, Hexobarbital
    DB01892, Hyperforin
    DB01050, Ibuprofen
    DB00159, Icosapent
    DB01181, Ifosfamide
    DB00619, Imatinib
    DB00328, Indomethacin
    DB01029, Irbesartan
    DB01221, Ketamine
    DB06738, Ketobemidone
    DB01009, Ketoprofen
    DB00465, Ketorolac
    DB06725, Lornoxicam
    DB09212, Loxoprofen
    DB01283, Lumiracoxib
    DB01397, Magnesium salicylate
    DB00939, Meclofenamic acid
    DB14009, Medical Cannabis
    DB00784, Mefenamic acid
    DB00814, Meloxicam
    DB11201, Menthyl salicylate
    DB00244, Mesalazine
    DB04817, Metamizole
    DB00350, Minoxidil
    DB00471, Montelukast
    DB14011, Nabiximols
    DB00461, Nabumetone
    DB00788, Naproxen
    DB00731, Nateglinide
    DB06802, Nepafenac
    DB04552, Niflumic acid
    DB12445, Nitroaspirin
    DB01837, O-acetyl-L-serine
    DB00991, Oxaprozin
    DB03752, P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid
    DB03783, Phenacetin
    DB11071, Phenyl salicylate
    DB00812, Phenylbutazone
    DB00554, Piroxicam
    DB09288, Propacetamol
    DB02110, Protoporphyrin Ix Containing Co
    DB02709, Resveratrol
    DB00533, Rofecoxib
    DB00412, Rosiglitazone
    DB00936, Salicylic acid
    DB01399, Salsalate
    DB06739, Seratrodast
    DB00795, Sulfasalazine
    DB00605, Sulindac
    DB00870, Suprofen
    DB09295, Talniflumate
    DB00469, Tenoxicam
    DB00857, Terbinafine
    DB01041, Thalidomide
    DB01600, Tiaprofenic acid
    DB09216, Tolfenamic acid
    DB00500, Tolmetin
    DB05109, Trabectedin
    DB08814, Triflusal
    DB11079, Trolamine salicylate
    DB00313, Valproic acid
    DB00582, Voriconazole
    DB00549, Zafirlukast
    DB06737, Zaltoprofen
    DB00744, Zileuton
    DB01198, Zopiclone

    DrugCentral

    More...    DrugCentrali    		P23219

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...    GuidetoPHARMACOLOGYi    		1375

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		PTGS1

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		317373262

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Add BLAST23
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002386824 – 599Prostaglandin G/H synthase 1Add BLAST576

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi35 ↔ 46By similarity
    Disulfide bondi36 ↔ 158By similarity
    Disulfide bondi40 ↔ 56By similarity
    Disulfide bondi58 ↔ 68By similarity
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1
    Disulfide bondi568 ↔ 574By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		P23219

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		P23219

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...    MassIVEi    		P23219

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		P23219

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		P23219

    PeptideAtlas

    More...    PeptideAtlasi    		P23219

    PRoteomics IDEntifications database

    More...    PRIDEi    		P23219

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		4239
    54063 [P23219-1]
    54064 [P23219-2]

    PTM databases

    GlyConnect protein glycosylation platform

    More...    GlyConnecti    		1648, 1 N-Linked glycan (1 site)

    GlyGen: Computational and Informatics Resources for Glycoscience

    More...    GlyGeni    		P23219, 3 sites

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		P23219

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		P23219

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000095303, Expressed in fundus of stomach and 222 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		P23219, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		P23219, HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		ENSG00000095303, Tissue enhanced (smooth muscle, urinary bladder)

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homodimer.

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		111714, 8 interactors

    CORUM comprehensive resource of mammalian protein complexes

    More...    CORUMi    		P23219

    Protein interaction database and analysis system

    More...    IntActi    		P23219, 3 interactors

    Molecular INTeraction database

    More...    MINTi    		P23219

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000354612

    Chemistry databases

    BindingDB database of measured binding affinities

    More...    BindingDBi    		P23219

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		P23219, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1599
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		P23219

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    Protein Data Bank in Europe - Knowledge Base

    More...    PDBe-KBi    		Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 69EGF-likePROSITE-ProRule annotationAdd BLAST39

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the prostaglandin G/H synthase family.Curated

    Keywords - Domaini

    EGF-like domain, Signal

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG2408, Eukaryota

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00390000010743

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_022428_0_0_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		P23219

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		SWEAYAN

    Database of Orthologous Groups

    More...    OrthoDBi    		324380at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		P23219

    TreeFam database of animal gene trees

    More...    TreeFami    		TF329675

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		1.10.640.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR029580, COX-1
    IPR000742, EGF-like_dom
    IPR019791, Haem_peroxidase_animal
    IPR010255, Haem_peroxidase_sf
    IPR037120, Haem_peroxidase_sf_animal

    The PANTHER Classification System

    More...    PANTHERi    		PTHR11903:SF6, PTHR11903:SF6, 1 hit

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF03098, An_peroxidase, 1 hit
    PF00008, EGF, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...    PRINTSi    		PR00457, ANPEROXIDASE

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF48113, SSF48113, 1 hit

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS50026, EGF_3, 1 hit
    PS50292, PEROXIDASE_3, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: P23219-1) [UniParc]FASTAAdd to basket
    Also known as: Long

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MSRSLLLWFL LFLLLLPPLP VLLADPGAPT PVNPCCYYPC QHQGICVRFG 
            60         70         80         90        100
    LDRYQCDCTR TGYSGPNCTI PGLWTWLRNS LRPSPSFTHF LLTHGRWFWE 
           110        120        130        140        150
    FVNATFIREM LMRLVLTVRS NLIPSPPTYN SAHDYISWES FSNVSYYTRI 
           160        170        180        190        200
    LPSVPKDCPT PMGTKGKKQL PDAQLLARRF LLRRKFIPDP QGTNLMFAFF 
           210        220        230        240        250
    AQHFTHQFFK TSGKMGPGFT KALGHGVDLG HIYGDNLERQ YQLRLFKDGK 
           260        270        280        290        300
    LKYQVLDGEM YPPSVEEAPV LMHYPRGIPP QSQMAVGQEV FGLLPGLMLY 
           310        320        330        340        350
    ATLWLREHNR VCDLLKAEHP TWGDEQLFQT TRLILIGETI KIVIEEYVQQ 
           360        370        380        390        400
    LSGYFLQLKF DPELLFGVQF QYRNRIAMEF NHLYHWHPLM PDSFKVGSQE 
           410        420        430        440        450
    YSYEQFLFNT SMLVDYGVEA LVDAFSRQIA GRIGGGRNMD HHILHVAVDV 
           460        470        480        490        500
    IRESREMRLQ PFNEYRKRFG MKPYTSFQEL VGEKEMAAEL EELYGDIDAL 
           510        520        530        540        550
    EFYPGLLLEK CHPNSIFGES MIEIGAPFSL KGLLGNPICS PEYWKPSTFG 
           560        570        580        590 
    GEVGFNIVKT ATLKKLVCLN TKTCPYVSFR VPDASQDDGP AVERPSTEL
    Length:599
    Mass (Da):68,686
    Last modified:January 11, 2011 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1F4F734BCD00346D
    GO
    Isoform 2 (identifier: P23219-2) [UniParc]FASTAAdd to basket
    Also known as: Short

    The sequence of this isoform differs from the canonical sequence as follows:
         396-432: Missing.

    Show »
    Length:562
    Mass (Da):64,513
    Checksum:i7AB78D6FD94F5FF1
    GO
    Isoform 3 (identifier: P23219-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPV → MRKPRLM
         396-432: Missing.

    Show »
    Length:537
    Mass (Da):61,930
    Checksum:i9AD6A32F6FE7CF05
    GO
    Isoform 4 (identifier: P23219-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-109: Missing.

    Show »
    Length:490
    Mass (Da):56,085
    Checksum:i8C340B40B682E98C
    GO
    Isoform 5 (identifier: P23219-5) [UniParc]FASTAAdd to basket
    Also known as: 1b3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-3: MSR → MSRECDPGARWGIFLASGGALNARLSPSSLSSAG

    Show »
    Length:630
    Mass (Da):71,717
    Checksum:iB70763422AC0C249
    GO
    Isoform 6 (identifier: P23219-6) [UniParc]FASTAAdd to basket
    Also known as: 1b2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-3: MSR → MSRECDPGARWGIFLASWWSLECQLSPSSLSSAG

    Show »
    Length:630
    Mass (Da):72,010
    Checksum:i7A7080D69D5583C1
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    A0A087X296A0A087X296_HUMAN
    Cyclooxygenase-1
    PTGS1
    		551Annotation score:

    Annotation score:4 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A2R8YDM0A0A2R8YDM0_HUMAN
    Prostaglandin-endoperoxide synthase
    PTGS1
    		402Annotation score:

    Annotation score:3 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    X6RJD6X6RJD6_HUMAN
    Prostaglandin G/H synthase 1
    PTGS1
    		171Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A2R8Y6S0A0A2R8Y6S0_HUMAN
    Prostaglandin G/H synthase 1
    PTGS1
    		41Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti12F → L in AAA36439 (PubMed:2512924).Curated1
    Sequence conflicti113R → L in AAA36439 (PubMed:2512924).Curated1
    Sequence conflicti378M → T in AAA36439 (PubMed:2512924).Curated1
    Sequence conflicti423D → G in BAG65237 (PubMed:14702039).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0134518W → R9 PublicationsCorresponds to variant dbSNP:rs1236913Ensembl.1
    Natural variantiVAR_01345217P → L2 PublicationsCorresponds to variant dbSNP:rs3842787Ensembl.1
    Natural variantiVAR_01916153R → H1 PublicationCorresponds to variant dbSNP:rs3842789Ensembl.1
    Natural variantiVAR_019162149R → L1 PublicationCorresponds to variant dbSNP:rs10306140Ensembl.1
    Natural variantiVAR_056663185K → T. Corresponds to variant dbSNP:rs3842792Ensembl.1
    Natural variantiVAR_019163237L → M2 PublicationsCorresponds to variant dbSNP:rs5789Ensembl.1
    Natural variantiVAR_056664341K → R. Corresponds to variant dbSNP:rs3842799Ensembl.1
    Natural variantiVAR_013453359K → R. Corresponds to variant dbSNP:rs5791Ensembl.1
    Natural variantiVAR_013454443I → V. Corresponds to variant dbSNP:rs5792Ensembl.1
    Natural variantiVAR_028017481V → I1 PublicationCorresponds to variant dbSNP:rs5794Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0469321 – 109Missing in isoform 4. 1 PublicationAdd BLAST109
    Alternative sequenceiVSP_0539361 – 32MSRSL…APTPV → MRKPRLM in isoform 3. 1 PublicationAdd BLAST32
    Alternative sequenceiVSP_0548621 – 3MSR → MSRECDPGARWGIFLASGGA LNARLSPSSLSSAG in isoform 5. 1 Publication3
    Alternative sequenceiVSP_0548631 – 3MSR → MSRECDPGARWGIFLASWWS LECQLSPSSLSSAG in isoform 6. 1 Publication3
    Alternative sequenceiVSP_004673396 – 432Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		M31822 M31821 Genomic DNA Translation: AAA36439.1
    M59979 mRNA Translation: AAA03630.1
    S78220 mRNA Translation: AAB21215.1
    S36219 mRNA Translation: AAB22216.1
    S36271 mRNA Translation: AAB22217.1
    DQ180741 mRNA Translation: ABA60098.1
    DQ180742 mRNA Translation: ABA60099.1
    AF440204 Genomic DNA Translation: AAL33601.1
    AK290022 mRNA Translation: BAF82711.1
    AK295221 mRNA Translation: BAG58214.1
    AK304403 mRNA Translation: BAG65237.1
    AY449688 Genomic DNA Translation: AAR08907.1
    AL162424 Genomic DNA No translation available.
    AL359636 Genomic DNA No translation available.
    CH471090 Genomic DNA Translation: EAW87530.1
    BC029840 mRNA Translation: AAH29840.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS59520.1 [P23219-3]
    CCDS59521.1 [P23219-4]
    CCDS6842.1 [P23219-1]
    CCDS6843.1 [P23219-2]

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		JH0259

    NCBI Reference Sequences

    More...    RefSeqi    		NP_000953.2, NM_000962.3 [P23219-1]
    NP_001258094.1, NM_001271165.1 [P23219-4]
    NP_001258095.1, NM_001271166.1
    NP_001258297.1, NM_001271368.1 [P23219-3]
    NP_542158.1, NM_080591.2 [P23219-2]
    XP_011517178.1, XM_011518876.2 [P23219-4]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000223423; ENSP00000223423; ENSG00000095303 [P23219-2]
    ENST00000362012; ENSP00000354612; ENSG00000095303 [P23219-1]
    ENST00000373698; ENSP00000362802; ENSG00000095303 [P23219-4]
    ENST00000540753; ENSP00000437709; ENSG00000095303 [P23219-3]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		5742

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:5742

    UCSC genome browser

    More...    UCSCi    		uc004bmf.3, human [P23219-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    <p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		M31822 M31821 Genomic DNA Translation: AAA36439.1
    M59979 mRNA Translation: AAA03630.1
    S78220 mRNA Translation: AAB21215.1
    S36219 mRNA Translation: AAB22216.1
    S36271 mRNA Translation: AAB22217.1
    DQ180741 mRNA Translation: ABA60098.1
    DQ180742 mRNA Translation: ABA60099.1
    AF440204 Genomic DNA Translation: AAL33601.1
    AK290022 mRNA Translation: BAF82711.1
    AK295221 mRNA Translation: BAG58214.1
    AK304403 mRNA Translation: BAG65237.1
    AY449688 Genomic DNA Translation: AAR08907.1
    AL162424 Genomic DNA No translation available.
    AL359636 Genomic DNA No translation available.
    CH471090 Genomic DNA Translation: EAW87530.1
    BC029840 mRNA Translation: AAH29840.1
    CCDSiCCDS59520.1 [P23219-3]
    CCDS59521.1 [P23219-4]
    CCDS6842.1 [P23219-1]
    CCDS6843.1 [P23219-2]
    PIRiJH0259
    RefSeqiNP_000953.2, NM_000962.3 [P23219-1]
    NP_001258094.1, NM_001271165.1 [P23219-4]
    NP_001258095.1, NM_001271166.1
    NP_001258297.1, NM_001271368.1 [P23219-3]
    NP_542158.1, NM_080591.2 [P23219-2]
    XP_011517178.1, XM_011518876.2 [P23219-4]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...    PDBei

    Protein Data Bank RCSB

    More...    RCSB PDBi

    Protein Data Bank Japan

    More...    PDBji
    Links Updated
    		PDB entryMethodResolution (Å)ChainPositionsPDBsum
    6Y3CX-ray3.36A24-599[»]
    SMRiP23219
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi111714, 8 interactors
    CORUMiP23219
    IntActiP23219, 3 interactors
    MINTiP23219
    STRINGi9606.ENSP00000354612

    Chemistry databases

    BindingDBiP23219
    ChEMBLiCHEMBL221
    DrugBankiDB02047, (+)-2-(4-biphenyl)propionic acid
    DB02773, (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid
    DB07983, 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID
    DB07981, 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1R)-1-(hydroxymethyl)propyl]acetamide
    DB07984, 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1S)-1-(hydroxymethyl)propyl]acetamide
    DB02198, 2-Bromoacetyl Group
    DB06736, Aceclofenac
    DB13783, Acemetacin
    DB00316, Acetaminophen
    DB03667, Acetic Acid Salicyloyl-Amino-Ester
    DB00945, Acetylsalicylic acid
    DB01435, Antipyrine
    DB01419, Antrafenine
    DB04557, Arachidonic Acid
    DB01014, Balsalazide
    DB13501, Bendazac
    DB02379, Beta-D-Glucose
    DB00963, Bromfenac
    DB13346, Bufexamac
    DB13919, Candesartan
    DB00796, Candesartan cilexetil
    DB09061, Cannabidiol
    DB00821, Carprofen
    DB00672, Chlorpropamide
    DB01401, Choline magnesium trisalicylate
    DB00250, Dapsone
    DB00035, Desmopressin
    DB09213, Dexibuprofen
    DB09214, Dexketoprofen
    DB00829, Diazepam
    DB00586, Diclofenac
    DB00711, Diethylcarbamazine
    DB00861, Diflunisal
    DB00154, Dihomo-gamma-linolenic acid
    DB01075, Diphenhydramine
    DB00470, Dronabinol
    DB09215, Droxicam
    DB00216, Eletriptan
    DB00749, Etodolac
    DB00773, Etoposide
    DB00573, Fenoprofen
    DB02266, Flufenamic acid
    DB00712, Flurbiprofen
    DB03753, Flurbiprofen Methyl Ester
    DB11323, Glycol salicylate
    DB01355, Hexobarbital
    DB01892, Hyperforin
    DB01050, Ibuprofen
    DB00159, Icosapent
    DB01181, Ifosfamide
    DB00619, Imatinib
    DB00328, Indomethacin
    DB01029, Irbesartan
    DB01221, Ketamine
    DB06738, Ketobemidone
    DB01009, Ketoprofen
    DB00465, Ketorolac
    DB06725, Lornoxicam
    DB09212, Loxoprofen
    DB01283, Lumiracoxib
    DB01397, Magnesium salicylate
    DB00939, Meclofenamic acid
    DB14009, Medical Cannabis
    DB00784, Mefenamic acid
    DB00814, Meloxicam
    DB11201, Menthyl salicylate
    DB00244, Mesalazine
    DB04817, Metamizole
    DB00350, Minoxidil
    DB00471, Montelukast
    DB14011, Nabiximols
    DB00461, Nabumetone
    DB00788, Naproxen
    DB00731, Nateglinide
    DB06802, Nepafenac
    DB04552, Niflumic acid
    DB12445, Nitroaspirin
    DB01837, O-acetyl-L-serine
    DB00991, Oxaprozin
    DB03752, P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid
    DB03783, Phenacetin
    DB11071, Phenyl salicylate
    DB00812, Phenylbutazone
    DB00554, Piroxicam
    DB09288, Propacetamol
    DB02110, Protoporphyrin Ix Containing Co
    DB02709, Resveratrol
    DB00533, Rofecoxib
    DB00412, Rosiglitazone
    DB00936, Salicylic acid
    DB01399, Salsalate
    DB06739, Seratrodast
    DB00795, Sulfasalazine
    DB00605, Sulindac
    DB00870, Suprofen
    DB09295, Talniflumate
    DB00469, Tenoxicam
    DB00857, Terbinafine
    DB01041, Thalidomide
    DB01600, Tiaprofenic acid
    DB09216, Tolfenamic acid
    DB00500, Tolmetin
    DB05109, Trabectedin
    DB08814, Triflusal
    DB11079, Trolamine salicylate
    DB00313, Valproic acid
    DB00582, Voriconazole
    DB00549, Zafirlukast
    DB06737, Zaltoprofen
    DB00744, Zileuton
    DB01198, Zopiclone
    DrugCentraliP23219
    GuidetoPHARMACOLOGYi1375
    SwissLipidsiSLP:000001103

    Protein family/group databases

    MoonDBiP23219, Curated
    PeroxiBasei3320, HsPGHS01

    PTM databases

    GlyConnecti1648, 1 N-Linked glycan (1 site)
    GlyGeniP23219, 3 sites
    iPTMnetiP23219
    PhosphoSitePlusiP23219

    Polymorphism and mutation databases

    BioMutaiPTGS1
    DMDMi317373262

    Proteomic databases

    EPDiP23219
    jPOSTiP23219
    MassIVEiP23219
    MaxQBiP23219
    PaxDbiP23219
    PeptideAtlasiP23219
    PRIDEiP23219
    ProteomicsDBi4239
    54063 [P23219-1]
    54064 [P23219-2]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...    Antibodypediai    		775, 671 antibodies

    The DNASU plasmid repository

    More...    DNASUi    		5742

    Genome annotation databases

    EnsembliENST00000223423; ENSP00000223423; ENSG00000095303 [P23219-2]
    ENST00000362012; ENSP00000354612; ENSG00000095303 [P23219-1]
    ENST00000373698; ENSP00000362802; ENSG00000095303 [P23219-4]
    ENST00000540753; ENSP00000437709; ENSG00000095303 [P23219-3]
    GeneIDi5742
    KEGGihsa:5742
    UCSCiuc004bmf.3, human [P23219-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		5742
    DisGeNETi5742
    EuPathDBiHostDB:ENSG00000095303.14

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		PTGS1
    HGNCiHGNC:9604, PTGS1
    HPAiENSG00000095303, Tissue enhanced (smooth muscle, urinary bladder)
    MIMi176805, gene
    neXtProtiNX_P23219
    OpenTargetsiENSG00000095303
    PharmGKBiPA24346

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG2408, Eukaryota
    GeneTreeiENSGT00390000010743
    HOGENOMiCLU_022428_0_0_1
    InParanoidiP23219
    OMAiSWEAYAN
    OrthoDBi324380at2759
    PhylomeDBiP23219
    TreeFamiTF329675

    Enzyme and pathway databases

    UniPathwayiUPA00662
    BioCyciMetaCyc:HS01815-MONOMER
    BRENDAi1.14.99.1, 2681
    PathwayCommonsiP23219
    ReactomeiR-HSA-140180, COX reactions
    R-HSA-2162123, Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
    SABIO-RKiP23219
    SIGNORiP23219

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...    BioGRID-ORCSi    		5742, 4 hits in 846 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		PTGS1, human

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		PTGS1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		5742
    PharosiP23219, Tclin

    Protein Ontology

    More...    PROi    		PR:P23219
    RNActiP23219, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000095303, Expressed in fundus of stomach and 222 other tissues
    ExpressionAtlasiP23219, baseline and differential
    GenevisibleiP23219, HS

    Family and domain databases

    Gene3Di1.10.640.10, 1 hit
    InterProiView protein in InterPro
    IPR029580, COX-1
    IPR000742, EGF-like_dom
    IPR019791, Haem_peroxidase_animal
    IPR010255, Haem_peroxidase_sf
    IPR037120, Haem_peroxidase_sf_animal
    PANTHERiPTHR11903:SF6, PTHR11903:SF6, 1 hit
    PfamiView protein in Pfam
    PF03098, An_peroxidase, 1 hit
    PF00008, EGF, 1 hit
    PRINTSiPR00457, ANPEROXIDASE
    SUPFAMiSSF48113, SSF48113, 1 hit
    PROSITEiView protein in PROSITE
    PS50026, EGF_3, 1 hit
    PS50292, PEROXIDASE_3, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPGH1_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P23219
    Secondary accession number(s): A8K1V7
    , B4DHQ2, B4E2S5, Q15122, Q3HY28, Q3HY29, Q5T7T6, Q5T7T7, Q5T7T8
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
    Last sequence update: January 11, 2011
    Last modified: December 2, 2020
    This is version 216 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families
    7. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again