Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibulin-1

Gene

FBLN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP.3 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processHost-virus interaction
LigandCalcium

Enzyme and pathway databases

ReactomeiR-HSA-2129379 Molecules associated with elastic fibres

Names & Taxonomyi

Protein namesi
Recommended name:
Fibulin-1
Short name:
FIBL-1
Gene namesi
Name:FBLN1
ORF Names:PP213
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000077942.18
HGNCiHGNC:3600 FBLN1
MIMi135820 gene
neXtProtiNX_P23142

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving FBLN1 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with RASSF8. Fibroblasts derived from a patient with synpolydactyly displayed alterations in the level of isoform D splice variant incorporated into the ECM and secreted into the conditioned culture medium. By contrast, the expression of isoform C was not perturbed in the patients fibroblasts. Furthermore, no aberrant polypeptides were detected in extracts of cultured patients fibroblasts. The translocation t(12;22) may result in haploinsufficiency of the isoform D splice variant, which could lead to the observed limb malformation.1 Publication
Elevated expression and altered processing of FBLN1 protein is associated with human breast cancer.1 Publication

Organism-specific databases

DisGeNETi2192
MalaCardsiFBLN1
MIMi608180 phenotype
OpenTargetsiENSG00000077942
Orphaneti404451 FBLN1-related developmental delay-central nervous system anomaly-syndactyly syndrome
295197 Synpolydactyly type 2
PharmGKBiPA28013

Polymorphism and mutation databases

BioMutaiFBLN1
DMDMi215274249

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 291 PublicationAdd BLAST29
ChainiPRO_000000756330 – 703Fibulin-1Add BLAST674

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi36 ↔ 61By similarity
Disulfide bondi37 ↔ 68By similarity
Disulfide bondi50 ↔ 69By similarity
Disulfide bondi78 ↔ 109By similarity
Disulfide bondi91 ↔ 110By similarity
Glycosylationi98N-linked (GlcNAc...) (complex) asparagine1 Publication1
Disulfide bondi112 ↔ 136By similarity
Disulfide bondi113 ↔ 143By similarity
Disulfide bondi126 ↔ 144By similarity
Disulfide bondi180 ↔ 190By similarity
Disulfide bondi186 ↔ 199By similarity
Disulfide bondi201 ↔ 214By similarity
Disulfide bondi220 ↔ 233By similarity
Disulfide bondi227 ↔ 242By similarity
Disulfide bondi248 ↔ 260By similarity
Disulfide bondi266 ↔ 279By similarity
Disulfide bondi273 ↔ 288By similarity
Disulfide bondi294 ↔ 306By similarity
Disulfide bondi312 ↔ 325By similarity
Disulfide bondi319 ↔ 334By similarity
Disulfide bondi341 ↔ 354By similarity
Disulfide bondi360 ↔ 373By similarity
Disulfide bondi367 ↔ 382By similarity
Disulfide bondi384 ↔ 397By similarity
Disulfide bondi403 ↔ 415By similarity
Disulfide bondi411 ↔ 424By similarity
Disulfide bondi426 ↔ 439By similarity
Disulfide bondi445 ↔ 454By similarity
Disulfide bondi450 ↔ 463By similarity
Disulfide bondi465 ↔ 479By similarity
Disulfide bondi485 ↔ 498By similarity
Disulfide bondi494 ↔ 507By similarity
Disulfide bondi509 ↔ 523By similarity
Disulfide bondi529 ↔ 542By similarity
Glycosylationi535N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi536 ↔ 551By similarity
Glycosylationi539N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi556 ↔ 577By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiP23142
MaxQBiP23142
PaxDbiP23142
PeptideAtlasiP23142
PRIDEiP23142
ProteomicsDBi54057
54058 [P23142-2]
54059 [P23142-3]
54060 [P23142-4]

PTM databases

GlyConnecti1244
iPTMnetiP23142
PhosphoSitePlusiP23142

Expressioni

Tissue specificityi

Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells.1 Publication

Developmental stagei

Widely expressed during embryonic development. Prominent in the matrix of the leptomeningeal anlage, in basement membranes of the neuroepithelium and the perineurium of peripheral nerves. In embryos of gestational week (gw) 4, staining was observed in the early mesenchymal bone anlagen. In gw 6.5 and 8, all perichondrial structures showed expression but the chondrocytes themselves showed no staining. In gw 10, expression is prominent in the interterritorial matrix surrounding the hypertrophic chondrocytes.1 Publication

Inductioni

Expression increased by estrogen in ovarian cancer cells.3 Publications

Gene expression databases

BgeeiENSG00000077942 Expressed in 217 organ(s), highest expression level in endocervix
ExpressionAtlasiP23142 baseline and differential
GenevisibleiP23142 HS

Organism-specific databases

HPAiCAB004393
CAB068187
HPA001612
HPA001613

Interactioni

Subunit structurei

Homomultimerizes and interacts with various extracellular matrix components such as FN1, LAMA1, LAMA2, NID, ACAN, CSPG2 and type IV collagen. Interacts also with APP, NOV and FGB. Interacts with FBLN7 (By similarity).By similarity
(Microbial infection) Interacts with human papillomavirus/HPV type 16, 18 and 31 proteins E6.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
LCE5AQ5TCM94EBI-11956479,EBI-11955689

GO - Molecular functioni

Protein-protein interaction databases

BioGridi108486, 72 interactors
IntActiP23142, 55 interactors
MINTiP23142
STRINGi9606.ENSP00000331544

Structurei

3D structure databases

ProteinModelPortaliP23142
SMRiP23142
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 76Anaphylatoxin-like 1PROSITE-ProRule annotationAdd BLAST41
Domaini77 – 111Anaphylatoxin-like 2PROSITE-ProRule annotationAdd BLAST35
Domaini112 – 144Anaphylatoxin-like 3PROSITE-ProRule annotationAdd BLAST33
Domaini176 – 215EGF-like 1PROSITE-ProRule annotationAdd BLAST40
Domaini216 – 261EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST46
Domaini262 – 307EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST46
Domaini308 – 355EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST48
Domaini356 – 398EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini399 – 440EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini441 – 480EGF-like 7; calcium-bindingPROSITE-ProRule annotationAdd BLAST40
Domaini481 – 524EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd BLAST44
Domaini525 – 578EGF-like 9; calcium-bindingPROSITE-ProRule annotationAdd BLAST54

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni356 – 440Self-association and FN1-binding; calcium is necessary for homotypic binding, but not for heterotypic bindingAdd BLAST85

Sequence similaritiesi

Belongs to the fibulin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IR7F Eukaryota
ENOG410Y194 LUCA
GeneTreeiENSGT00760000118806
HOGENOMiHOG000007079
HOVERGENiHBG051559
InParanoidiP23142
KOiK17307
OMAiCHENQEC
PhylomeDBiP23142
TreeFamiTF317514

Family and domain databases

CDDicd00017 ANATO, 2 hits
InterProiView protein in InterPro
IPR000020 Anaphylatoxin/fibulin
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR017048 Fibulin-1
IPR009030 Growth_fac_rcpt_cys_sf
PfamiView protein in Pfam
PF12662 cEGF, 3 hits
PF07645 EGF_CA, 4 hits
PIRSFiPIRSF036313 Fibulin-1, 1 hit
SMARTiView protein in SMART
SM00104 ANATO, 3 hits
SM00181 EGF, 9 hits
SM00179 EGF_CA, 8 hits
SUPFAMiSSF57184 SSF57184, 2 hits
PROSITEiView protein in PROSITE
PS01177 ANAPHYLATOXIN_1, 3 hits
PS01178 ANAPHYLATOXIN_2, 3 hits
PS00010 ASX_HYDROXYL, 4 hits
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 5 hits
PS01187 EGF_CA, 8 hits

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform D (identifier: P23142-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERAAPSRRV PLPLLLLGGL ALLAAGVDAD VLLEACCADG HRMATHQKDC
60 70 80 90 100
SLPYATESKE CRMVQEQCCH SQLEELHCAT GISLANEQDR CATPHGDNAS
110 120 130 140 150
LEATFVKRCC HCCLLGRAAQ AQGQSCEYSL MVGYQCGQVF QACCVKSQET
160 170 180 190 200
GDLDVGGLQE TDKIIEVEEE QEDPYLNDRC RGGGPCKQQC RDTGDEVVCS
210 220 230 240 250
CFVGYQLLSD GVSCEDVNEC ITGSHSCRLG ESCINTVGSF RCQRDSSCGT
260 270 280 290 300
GYELTEDNSC KDIDECESGI HNCLPDFICQ NTLGSFRCRP KLQCKSGFIQ
310 320 330 340 350
DALGNCIDIN ECLSISAPCP IGHTCINTEG SYTCQKNVPN CGRGYHLNEE
360 370 380 390 400
GTRCVDVDEC APPAEPCGKG HRCVNSPGSF RCECKTGYYF DGISRMCVDV
410 420 430 440 450
NECQRYPGRL CGHKCENTLG SYLCSCSVGF RLSVDGRSCE DINECSSSPC
460 470 480 490 500
SQECANVYGS YQCYCRRGYQ LSDVDGVTCE DIDECALPTG GHICSYRCIN
510 520 530 540 550
IPGSFQCSCP SSGYRLAPNG RNCQDIDECV TGIHNCSINE TCFNIQGGFR
560 570 580 590 600
CLAFECPENY RRSAATLQQE KTDTVRCIKS CRPNDVTCVF DPVHTISHTV
610 620 630 640 650
ISLPTFREFT RPEEIIFLRA ITPPHPASQA NIIFDITEGN LRDSFDIIKR
660 670 680 690 700
YMDGMTVGVV RQVRPIVGPF HAVLKLEMNY VVGGVVSHRN VVNVHIFVSE

YWF
Length:703
Mass (Da):77,214
Last modified:November 25, 2008 - v4
Checksum:i302F7ED2DF34CA71
GO
Isoform A (identifier: P23142-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-703: Missing.

Show »
Length:566
Mass (Da):61,552
Checksum:i2F8AAA8886D2A1C0
GO
Isoform B (identifier: P23142-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-703: LQQEKTDTVR...VHIFVSEYWF → QKSKKGRQNTPAGSSKEDCRVLPWKQGLEDTHLDA

Show »
Length:601
Mass (Da):65,443
Checksum:i2203FEF959DB3925
GO
Isoform C (identifier: P23142-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-703: LQQEKTDTVR...VHIFVSEYWF → RCERLPCHEN...KLFIFVSAEL

Show »
Length:683
Mass (Da):74,434
Checksum:iB6B9ED49F590F612
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AHL2B1AHL2_HUMAN
Fibulin-1
FBLN1
721Annotation score:
B1AHN3B1AHN3_HUMAN
Fibulin-1
FBLN1
172Annotation score:
H7C1M6H7C1M6_HUMAN
Fibulin-1
FBLN1
183Annotation score:
B1AHM8B1AHM8_HUMAN
Fibulin-1
FBLN1
181Annotation score:
B1AHM9B1AHM9_HUMAN
Fibulin-1
FBLN1
189Annotation score:
B1AHM7B1AHM7_HUMAN
Fibulin-1
FBLN1
139Annotation score:
B1AHM6B1AHM6_HUMAN
Fibulin-1
FBLN1
65Annotation score:
B1AHM5B1AHM5_HUMAN
Fibulin-1
FBLN1
92Annotation score:
A0A0U1RRA4A0A0U1RRA4_HUMAN
Fibulin-1
FBLN1
60Annotation score:

Sequence cautioni

The sequence AAG17241 differs from that shown. Reason: Frameshift at positions 116, 619 and 639.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti13P → Q in AAH22497 (PubMed:15489334).Curated1
Sequence conflicti36C → S AA sequence (PubMed:2527614).Curated1
Sequence conflicti41 – 42HR → SH AA sequence (PubMed:2527614).Curated2
Sequence conflicti521R → S in AAH22497 (PubMed:15489334).Curated1
Sequence conflicti548G → A in CAA37770 (PubMed:2269669).Curated1
Sequence conflicti548G → A in CAA37771 (PubMed:2269669).Curated1
Sequence conflicti548G → A in CAA37772 (PubMed:2269669).Curated1
Sequence conflicti548G → A in AAB17099 (PubMed:9106159).Curated1
Sequence conflicti548G → A in AAK37822 (PubMed:10318851).Curated1
Isoform C (identifier: P23142-4)
Sequence conflicti650E → K in AAG17241 (PubMed:15498874).1
Sequence conflicti662L → F in AAG17241 (PubMed:15498874).1
Sequence conflicti680 – 682SAE → FAK in AAG17241 (PubMed:15498874).3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_015650141Q → R5 PublicationsCorresponds to variant dbSNP:rs136730Ensembl.1
Natural variantiVAR_072739397C → F Found in a family with syndactyly, undescended testes, delayed motor milestones, mental retardation and signs of brain atrophy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs397509432EnsemblClinVar.1
Natural variantiVAR_055720509C → S. Corresponds to variant dbSNP:rs1802787Ensembl.1
Natural variantiVAR_055721695H → R1 PublicationCorresponds to variant dbSNP:rs13268Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001383567 – 703Missing in isoform A. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_001384567 – 703LQQEK…SEYWF → QKSKKGRQNTPAGSSKEDCR VLPWKQGLEDTHLDA in isoform B. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_001385567 – 703LQQEK…SEYWF → RCERLPCHENRECSKLPLRI TYYHLSFPTNIQAPAVVFRM GPSSAVPGDSMQLAITGGNE EGFFTTRKVSPHSGVVALTK PVPEPRDLLLTVKMDLSRHG TVSSFVAKLFIFVSAEL in isoform C. 3 PublicationsAdd BLAST137

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X53741 mRNA Translation: CAA37770.1
X53742 mRNA Translation: CAA37771.1
X53743 mRNA Translation: CAA37772.1
U01244 mRNA Translation: AAB17099.1
AF126110 mRNA Translation: AAK37822.1
AF217999 mRNA Translation: AAG17241.1 Frameshift.
AL021391 Genomic DNA No translation available.
Z95331 Genomic DNA No translation available.
Z98047 Genomic DNA No translation available.
BC022497 mRNA Translation: AAH22497.1
AY040589 Genomic DNA Translation: AAK82945.1
CCDSiCCDS14067.1 [P23142-1]
CCDS14068.1 [P23142-3]
CCDS14069.1 [P23142-4]
CCDS43028.1 [P23142-2]
PIRiC36346
RefSeqiNP_001987.2, NM_001996.3
NP_006476.2, NM_006485.3
NP_006477.2, NM_006486.2
NP_006478.2, NM_006487.2
UniGeneiHs.24601

Genome annotation databases

EnsembliENST00000262722; ENSP00000262722; ENSG00000077942 [P23142-4]
ENST00000327858; ENSP00000331544; ENSG00000077942 [P23142-1]
ENST00000340923; ENSP00000342212; ENSG00000077942 [P23142-2]
ENST00000442170; ENSP00000393812; ENSG00000077942 [P23142-3]
GeneIDi2192
KEGGihsa:2192
UCSCiuc003bgg.2 human [P23142-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X53741 mRNA Translation: CAA37770.1
X53742 mRNA Translation: CAA37771.1
X53743 mRNA Translation: CAA37772.1
U01244 mRNA Translation: AAB17099.1
AF126110 mRNA Translation: AAK37822.1
AF217999 mRNA Translation: AAG17241.1 Frameshift.
AL021391 Genomic DNA No translation available.
Z95331 Genomic DNA No translation available.
Z98047 Genomic DNA No translation available.
BC022497 mRNA Translation: AAH22497.1
AY040589 Genomic DNA Translation: AAK82945.1
CCDSiCCDS14067.1 [P23142-1]
CCDS14068.1 [P23142-3]
CCDS14069.1 [P23142-4]
CCDS43028.1 [P23142-2]
PIRiC36346
RefSeqiNP_001987.2, NM_001996.3
NP_006476.2, NM_006485.3
NP_006477.2, NM_006486.2
NP_006478.2, NM_006487.2
UniGeneiHs.24601

3D structure databases

ProteinModelPortaliP23142
SMRiP23142
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108486, 72 interactors
IntActiP23142, 55 interactors
MINTiP23142
STRINGi9606.ENSP00000331544

PTM databases

GlyConnecti1244
iPTMnetiP23142
PhosphoSitePlusiP23142

Polymorphism and mutation databases

BioMutaiFBLN1
DMDMi215274249

Proteomic databases

EPDiP23142
MaxQBiP23142
PaxDbiP23142
PeptideAtlasiP23142
PRIDEiP23142
ProteomicsDBi54057
54058 [P23142-2]
54059 [P23142-3]
54060 [P23142-4]

Protocols and materials databases

DNASUi2192
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262722; ENSP00000262722; ENSG00000077942 [P23142-4]
ENST00000327858; ENSP00000331544; ENSG00000077942 [P23142-1]
ENST00000340923; ENSP00000342212; ENSG00000077942 [P23142-2]
ENST00000442170; ENSP00000393812; ENSG00000077942 [P23142-3]
GeneIDi2192
KEGGihsa:2192
UCSCiuc003bgg.2 human [P23142-1]

Organism-specific databases

CTDi2192
DisGeNETi2192
EuPathDBiHostDB:ENSG00000077942.18
GeneCardsiFBLN1
HGNCiHGNC:3600 FBLN1
HPAiCAB004393
CAB068187
HPA001612
HPA001613
MalaCardsiFBLN1
MIMi135820 gene
608180 phenotype
neXtProtiNX_P23142
OpenTargetsiENSG00000077942
Orphaneti404451 FBLN1-related developmental delay-central nervous system anomaly-syndactyly syndrome
295197 Synpolydactyly type 2
PharmGKBiPA28013
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IR7F Eukaryota
ENOG410Y194 LUCA
GeneTreeiENSGT00760000118806
HOGENOMiHOG000007079
HOVERGENiHBG051559
InParanoidiP23142
KOiK17307
OMAiCHENQEC
PhylomeDBiP23142
TreeFamiTF317514

Enzyme and pathway databases

ReactomeiR-HSA-2129379 Molecules associated with elastic fibres

Miscellaneous databases

ChiTaRSiFBLN1 human
GeneWikiiFBLN1
GenomeRNAii2192
PROiPR:P23142
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000077942 Expressed in 217 organ(s), highest expression level in endocervix
ExpressionAtlasiP23142 baseline and differential
GenevisibleiP23142 HS

Family and domain databases

CDDicd00017 ANATO, 2 hits
InterProiView protein in InterPro
IPR000020 Anaphylatoxin/fibulin
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR017048 Fibulin-1
IPR009030 Growth_fac_rcpt_cys_sf
PfamiView protein in Pfam
PF12662 cEGF, 3 hits
PF07645 EGF_CA, 4 hits
PIRSFiPIRSF036313 Fibulin-1, 1 hit
SMARTiView protein in SMART
SM00104 ANATO, 3 hits
SM00181 EGF, 9 hits
SM00179 EGF_CA, 8 hits
SUPFAMiSSF57184 SSF57184, 2 hits
PROSITEiView protein in PROSITE
PS01177 ANAPHYLATOXIN_1, 3 hits
PS01178 ANAPHYLATOXIN_2, 3 hits
PS00010 ASX_HYDROXYL, 4 hits
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 5 hits
PS01187 EGF_CA, 8 hits
ProtoNetiSearch...

Entry informationi

Entry nameiFBLN1_HUMAN
AccessioniPrimary (citable) accession number: P23142
Secondary accession number(s): B0QY42
, B1AHL4, P23143, P23144, P37888, Q5TIC4, Q8TBH8, Q9HBQ5, Q9UC21, Q9UGR4, Q9UH41
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 25, 2008
Last modified: November 7, 2018
This is version 223 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again