Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 208 (07 Apr 2021)
Sequence version 1 (01 Nov 1991)
Previous versions | rss
Add a publicationFeedback
Protein

Protein doublesex

Gene

dsx

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Controls somatic sexual differentiation. Binds directly and specifically to the FBE (fat body enhancer) of the yolk protein 1 and 2 genes (Yp1 and Yp2). This enhancer is sufficient to direct the female-specific transcription characteristic of the Yp genes in adult fat bodies. Involved in regulation of male-specific expression of takeout in brain-associated fat body.1 Publication

Miscellaneous

Experimentally shown to bind zinc.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi44 – 91DMPROSITE-ProRule annotationAdd BLAST48

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processDifferentiation, Sexual differentiation, Transcription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein doublesex
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:dsx
ORF Names:CG11094
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0000504, dsx

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi47C → A or H: Abolishes DNA-binding. 1 Publication1
Mutagenesisi50H → Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi59H → Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi68C → D or Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi70C → Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi91R → Q: Abolishes DNA-binding. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002070411 – 549Protein doublesexAdd BLAST549

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P23023

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0000504, Expressed in spermathecum and 38 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P23023, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P23023, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
66125, 66 interactors

Database of interacting proteins

More...
DIPi
DIP-17110N

Protein interaction database and analysis system

More...
IntActi
P23023, 26 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0081256

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1549
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P23023

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P23023

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi119 – 224His-richAdd BLAST106
Compositional biasi267 – 296Gly/Ser-richAdd BLAST30

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3815, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P23023

Identification of Orthologs from Complete Genome Data

More...
OMAi
SADHMTT

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P23023

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.1040.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001275, DM_DNA-bd
IPR036407, DM_DNA-bd_sf
IPR026607, DMRT/dsx/mab-3
IPR014932, DSX_dimer

The PANTHER Classification System

More...
PANTHERi
PTHR12322, PTHR12322, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00751, DM, 1 hit
PF08828, DSX_dimer, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00301, DM, 1 hit
SM01143, DSX_dimer, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF82927, SSF82927, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS40000, DM_1, 1 hit
PS50809, DM_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Male (identifier: P23023-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSEENWNSD TMSDSDMIDS KNDVCGGASS SSGSSISPRT PPNCARCRNH
60 70 80 90 100
GLKITLKGHK RYCKFRYCTC EKCRLTADRQ RVMALQTALR RAQAQDEQRA
110 120 130 140 150
LHMHEVPPAN PAATTLLSHH HHVAAPAHVH AHHVHAHHAH GGHHSHHGHV
160 170 180 190 200
LHHQQAAAAA AAAPSAPASH LGGSSTAASS IHGHAHAHHV HMAAAAAASV
210 220 230 240 250
AQHQHQSHPH SHHHHHQNHH QHPHQQPATQ TALRSPPHSD HGGSVGPATS
260 270 280 290 300
SSGGGAPSSS NAAAATSSNG SSGGGGGGGG GSSGGGAGGG RSSGTSVITS
310 320 330 340 350
ADHHMTTVPT PAQSLEGSCD SSSPSPSSTS GAAILPISVS VNRKNGANVP
360 370 380 390 400
LGQDVFLDYC QKLLEKFRYP WELMPLMYVI LKDADANIEE ASRRIEEARV
410 420 430 440 450
EINRTVAQIY YNYYTPMALV NGAPMYLTYP SIEQGRYGAH FTHLPLTQIC
460 470 480 490 500
PPTPEPLALS RSPSSPSGPS AVHNQKPSRP GSSNGTVHSA ASPTMVTTMA
510 520 530 540
TTSSTPTLSR RQRSRSATPT TPPPPPPAHS SSNGAYHHGH HLVSSTAAT
Length:549
Mass (Da):57,409
Last modified:November 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3C1B92724E4CE083
GO
Isoform Female (identifier: P23023-2) [UniParc]FASTAAdd to basket
Also known as: B, C

The sequence of this isoform differs from the canonical sequence as follows:
     398-427: ARVEINRTVAQIYYNYYTPMALVNGAPMYL → GQYVVNEYSRQHNLNIYDGGELRNTTRQCG
     428-549: Missing.

Show »
Length:427
Mass (Da):44,768
Checksum:i75143686AC717315
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4KFS4A0A0B4KFS4_DROME
Doublesex, isoform D
dsx Dmdsx, Dmel\CG11094, DSX, Dsx, DSXF
549Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KGR7A0A0B4KGR7_DROME
Doublesex, isoform E
dsx Dmdsx, Dmel\CG11094, DSX, Dsx, DSXF
572Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4LGS9A0A0B4LGS9_DROME
Doublesex, isoform F
dsx Dmdsx, Dmel\CG11094, DSX, Dsx, DSXF
427Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53K → N in AAL25296 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001321398 – 427ARVEI…APMYL → GQYVVNEYSRQHNLNIYDGG ELRNTTRQCG in isoform Female. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_001322428 – 549Missing in isoform Female. 2 PublicationsAdd BLAST122

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M25292 mRNA Translation: AAA17840.1
M25293 mRNA Translation: AAA17841.1
M25294 mRNA Translation: AAA17842.1
AE014297 Genomic DNA Translation: AAF54169.1
AE014297 Genomic DNA Translation: AAN13385.1
AY060257 mRNA Translation: AAL25296.1
BT029258 mRNA Translation: ABK30895.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A32372
B32372

NCBI Reference Sequences

More...
RefSeqi
NP_001262352.1, NM_001275423.1 [P23023-1]
NP_001287220.1, NM_001300291.1 [P23023-2]
NP_524272.4, NM_079548.5 [P23023-2]
NP_731197.1, NM_169202.1 [P23023-1]
NP_731198.1, NM_169203.2 [P23023-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0081759; FBpp0081256; FBgn0000504 [P23023-1]
FBtr0081760; FBpp0081257; FBgn0000504 [P23023-2]
FBtr0081761; FBpp0081258; FBgn0000504 [P23023-2]
FBtr0330073; FBpp0303106; FBgn0000504 [P23023-1]
FBtr0339710; FBpp0308767; FBgn0000504 [P23023-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
40940

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG11094

UCSC genome browser

More...
UCSCi
CG11094-RA, d. melanogaster [P23023-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25292 mRNA Translation: AAA17840.1
M25293 mRNA Translation: AAA17841.1
M25294 mRNA Translation: AAA17842.1
AE014297 Genomic DNA Translation: AAF54169.1
AE014297 Genomic DNA Translation: AAN13385.1
AY060257 mRNA Translation: AAL25296.1
BT029258 mRNA Translation: ABK30895.1
PIRiA32372
B32372
RefSeqiNP_001262352.1, NM_001275423.1 [P23023-1]
NP_001287220.1, NM_001300291.1 [P23023-2]
NP_524272.4, NM_079548.5 [P23023-2]
NP_731197.1, NM_169202.1 [P23023-1]
NP_731198.1, NM_169203.2 [P23023-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LPVNMR-A35-86[»]
1ZV1X-ray1.60A/B350-397[»]
2JZ0NMR-A/B350-397[»]
2JZ1NMR-A/B350-397[»]
SMRiP23023
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi66125, 66 interactors
DIPiDIP-17110N
IntActiP23023, 26 interactors
STRINGi7227.FBpp0081256

Proteomic databases

PaxDbiP23023

Genome annotation databases

EnsemblMetazoaiFBtr0081759; FBpp0081256; FBgn0000504 [P23023-1]
FBtr0081760; FBpp0081257; FBgn0000504 [P23023-2]
FBtr0081761; FBpp0081258; FBgn0000504 [P23023-2]
FBtr0330073; FBpp0303106; FBgn0000504 [P23023-1]
FBtr0339710; FBpp0308767; FBgn0000504 [P23023-2]
GeneIDi40940
KEGGidme:Dmel_CG11094
UCSCiCG11094-RA, d. melanogaster [P23023-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
40940
FlyBaseiFBgn0000504, dsx

Phylogenomic databases

eggNOGiKOG3815, Eukaryota
InParanoidiP23023
OMAiSADHMTT
PhylomeDBiP23023

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
40940, 0 hits in 3 CRISPR screens
EvolutionaryTraceiP23023

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
40940

Protein Ontology

More...
PROi
PR:P23023

Gene expression databases

BgeeiFBgn0000504, Expressed in spermathecum and 38 other tissues
ExpressionAtlasiP23023, baseline and differential
GenevisibleiP23023, DM

Family and domain databases

Gene3Di4.10.1040.10, 1 hit
InterProiView protein in InterPro
IPR001275, DM_DNA-bd
IPR036407, DM_DNA-bd_sf
IPR026607, DMRT/dsx/mab-3
IPR014932, DSX_dimer
PANTHERiPTHR12322, PTHR12322, 1 hit
PfamiView protein in Pfam
PF00751, DM, 1 hit
PF08828, DSX_dimer, 1 hit
SMARTiView protein in SMART
SM00301, DM, 1 hit
SM01143, DSX_dimer, 1 hit
SUPFAMiSSF82927, SSF82927, 1 hit
PROSITEiView protein in PROSITE
PS40000, DM_1, 1 hit
PS50809, DM_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDSX_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P23023
Secondary accession number(s): P23022
, Q0KIA7, Q95TA5, Q9VHY0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 1, 1991
Last modified: April 7, 2021
This is version 208 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again