Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We are aiming to switch to the new UniProt website on Monday, May 9. Please explore and share your feedback. Take me to the new website.

UniProtKB - P22736 (NR4A1_HUMAN)

Entry version 225 (23 Feb 2022)
Sequence version 1 (01 Aug 1991)
Previous versions | rss
Add a publicationFeedback
Protein

Nuclear receptor subfamily 4 group A member 1

Gene

NR4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity).

May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation. Plays a role in the vascular response to injury (By similarity).

By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi264 – 339Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri267 – 287NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri303 – 327NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P22736

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-198693, AKT phosphorylates targets in the nucleus
R-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-5674400, Constitutive Signaling by AKT1 E17K in Cancer

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P22736

SIGNOR Signaling Network Open Resource

More...SIGNORi		P22736

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		P22736, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear receptor subfamily 4 group A member 1
Alternative name(s):
Early response protein NAK1
Nuclear hormone receptor NUR/77
Short name:
Nur77
Orphan nuclear receptor HMR
Orphan nuclear receptor TR3
ST-59
Testicular receptor 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NR4A1
Synonyms:GFRP1, HMR, NAK1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7980, NR4A1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		139139, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P22736

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000123358

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1 – 50Missing : No impact on the interaction with RXRA. 1 PublicationAdd BLAST50
Mutagenesisi299 – 361Missing : Loss of interaction with RXRA. 1 PublicationAdd BLAST63
Mutagenesisi595T → E: Strongly weakens interaction with STK11. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		3164

Open Targets

More...OpenTargetsi		ENSG00000123358

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31761

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P22736, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1293229

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NR4A1

Domain mapping of disease mutations (DMDM)

More...DMDMi		127819

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000537151 – 598Nuclear receptor subfamily 4 group A member 1Add BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei341Phosphoserine; by PKABy similarity1
Modified residuei351PhosphoserineCombined sources1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Ser-351 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli.1 Publication
Acetylated by p300/CBP, acetylation increases stability. Deacetylated by HDAC1.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P22736

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P22736

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P22736

MaxQB - The MaxQuant DataBase

More...MaxQBi		P22736

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P22736

PeptideAtlas

More...PeptideAtlasi		P22736

PRoteomics IDEntifications database

More...PRIDEi		P22736

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54032 [P22736-1]
54033 [P22736-2]
60662

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P22736, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P22736

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P22736

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Fetal muscle and adult liver, brain and thyroid.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By growth-stimulating agents.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000123358, Expressed in right adrenal gland and 236 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P22736, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P22736, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000123358, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a monomer (By similarity).

Interacts with GADD45GIP1 (PubMed:15459248).

Interacts with STK11 (PubMed:22983157).

Interacts with IFI27 (PubMed:22427340). Heterodimer (via DNA-binding domain) with RXRA (via C-terminus); DNA-binding of the heterodimer is enhanced by 9-cis retinoic acid (PubMed:17761950, PubMed:15509776). Competes for the RXRA interaction with EP300 and thereby attenuates EP300 mediated acetylation of RXRA (PubMed:17761950).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109407, 202 interactors

Database of interacting proteins

More...DIPi		DIP-40392N

Protein interaction database and analysis system

More...IntActi		P22736, 111 interactors

Molecular INTeraction database

More...MINTi		P22736

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000440864

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P22736

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P22736, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1598
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P22736

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P22736

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini360 – 595NR LBDPROSITE-ProRule annotationAdd BLAST236

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 44DisorderedSequence analysisAdd BLAST44
Regioni131 – 158DisorderedSequence analysisAdd BLAST28
Regioni171 – 466Required for nuclear import1 PublicationAdd BLAST296
Regioni177 – 206DisorderedSequence analysisAdd BLAST30
Regioni221 – 265DisorderedSequence analysisAdd BLAST45
Regioni299 – 361Required for the interaction with RXRA1 PublicationAdd BLAST63
Regioni341 – 361DisorderedSequence analysisAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi180 – 194Pro residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family. NR4 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri267 – 287NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri303 – 327NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4217, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183038

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_007368_14_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P22736

Identification of Orthologs from Complete Genome Data

More...OMAi		MEVIRKW

Database of Orthologous Groups

More...OrthoDBi		454476at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P22736

TreeFam database of animal gene trees

More...TreeFami		TF315430

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.565.10, 1 hit
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035500, NHR-like_dom_sf
IPR003071, Nuc_orp_HMR_rcpt
IPR003070, Nuc_orph_rcpt
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01285, HMRNUCRECPTR
PR01284, NUCLEARECPTR
PR00398, STRDHORMONER
PR00047, STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48508, SSF48508, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P22736-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPCIQAQYGT PAPSPGPRDH LASDPLTPEF IKPTMDLASP EAAPAAPTAL 
        60         70         80         90        100
PSFSTFMDGY TGEFDTFLYQ LPGTVQPCSS ASSSASSTSS SSATSPASAS 
       110        120        130        140        150
FKFEDFQVYG CYPGPLSGPV DEALSSSGSD YYGSPCSAPS PSTPSFQPPQ 
       160        170        180        190        200
LSPWDGSFGH FSPSQTYEGL RAWTEQLPKA SGPPQPPAFF SFSPPTGPSP 
       210        220        230        240        250
SLAQSPLKLF PSQATHQLGE GESYSMPTAF PGLAPTSPHL EGSGILDTPV 
       260        270        280        290        300
TSTKARSGAP GGSEGRCAVC GDNASCQHYG VRTCEGCKGF FKRTVQKNAK 
       310        320        330        340        350
YICLANKDCP VDKRRRNRCQ FCRFQKCLAV GMVKEVVRTD SLKGRRGRLP 
       360        370        380        390        400
SKPKQPPDAS PANLLTSLVR AHLDSGPSTA KLDYSKFQEL VLPHFGKEDA 
       410        420        430        440        450
GDVQQFYDLL SGSLEVIRKW AEKIPGFAEL SPADQDLLLE SAFLELFILR 
       460        470        480        490        500
LAYRSKPGEG KLIFCSGLVL HRLQCARGFG DWIDSILAFS RSLHSLLVDV 
       510        520        530        540        550
PAFACLSALV LITDRHGLQE PRRVEELQNR IASCLKEHVA AVAGEPQPAS 
       560        570        580        590 
CLSRLLGKLP ELRTLCTQGL QRIFYLKLED LVPPPPIIDK IFMDTLPF
Length:598
Mass (Da):64,463
Last modified:August 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i41DAAEA7C25FDA22
GO
Isoform 2 (identifier: P22736-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLAKACWSIQSEM

Show »
Length:611
Mass (Da):65,998
Checksum:i21F3BC282AE6BE8D
GO
Isoform 3 (identifier: P22736-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     293-325: RTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQ → VPRSPRWGLLLEMERGWPHPIGTCGLPLGSPPS
     326-598: Missing.

Show »
Length:325
Mass (Da):33,754
Checksum:iBCF2490A32A09175
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GXF0F5GXF0_HUMAN
Nuclear receptor subfamily 4 group ...
NR4A1
652Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BT85H3BT85_HUMAN
Nuclear receptor subfamily 4 group ...
NR4A1
302Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPN8H3BPN8_HUMAN
Nuclear receptor subfamily 4 group ...
NR4A1
150Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSB9H3BSB9_HUMAN
Nuclear receptor subfamily 4 group ...
NR4A1
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVX9F8VVX9_HUMAN
Nuclear receptor subfamily 4 group ...
NR4A1
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSM8H3BSM8_HUMAN
Nuclear receptor subfamily 4 group ...
NR4A1
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQG5H3BQG5_HUMAN
Nuclear receptor subfamily 4 group ...
NR4A1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti253T → I (PubMed:1651101).Curated1
Sequence conflicti262G → P in AAA36763 (PubMed:2626032).Curated1
Sequence conflicti360S → F in CAG32985 (Ref. 8) Curated1
Sequence conflicti370R → L in AAA36763 (PubMed:2626032).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06153426L → V. Corresponds to variant dbSNP:rs1882118Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0430861M → MWLAKACWSIQSEM in isoform 2. 1 Publication1
Alternative sequenceiVSP_047769293 – 325RTVQK…FCRFQ → VPRSPRWGLLLEMERGWPHP IGTCGLPLGSPPS in isoform 3. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_047770326 – 598Missing in isoform 3. 2 PublicationsAdd BLAST273

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D49728 mRNA Translation: BAA08565.1
L13740 mRNA Translation: AAA36763.1
D85245 mRNA Translation: BAA12746.1
AK297526 mRNA Translation: BAG59929.1
HQ692855 mRNA Translation: ADZ17366.1
AB307717 mRNA Translation: BAH02308.1
BT007144 mRNA Translation: AAP35808.1
AK314437 mRNA Translation: BAG37048.1
CR456704 mRNA Translation: CAG32985.1
AC025259 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58222.1
CH471111 Genomic DNA Translation: EAW58224.1
CH471111 Genomic DNA Translation: EAW58225.1
BC016147 mRNA Translation: AAH16147.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55828.1 [P22736-2]
CCDS8818.1 [P22736-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A37251

NCBI Reference Sequences

More...RefSeqi		NP_001189162.1, NM_001202233.1 [P22736-2]
NP_002126.2, NM_002135.4 [P22736-1]
NP_775180.1, NM_173157.2 [P22736-1]
XP_005268881.1, XM_005268824.3 [P22736-1]
XP_006719426.1, XM_006719363.1 [P22736-1]
XP_006719427.1, XM_006719364.3 [P22736-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000243050; ENSP00000243050; ENSG00000123358
ENST00000360284; ENSP00000353427; ENSG00000123358 [P22736-2]
ENST00000394824; ENSP00000378301; ENSG00000123358
ENST00000394825; ENSP00000378302; ENSG00000123358
ENST00000548232; ENSP00000449587; ENSG00000123358 [P22736-3]
ENST00000550082; ENSP00000449539; ENSG00000123358 [P22736-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3164

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3164

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000394825.6; ENSP00000378302.1; NM_173157.3; NP_775180.1

UCSC genome browser

More...UCSCi		uc001rzs.4, human [P22736-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49728 mRNA Translation: BAA08565.1
L13740 mRNA Translation: AAA36763.1
D85245 mRNA Translation: BAA12746.1
AK297526 mRNA Translation: BAG59929.1
HQ692855 mRNA Translation: ADZ17366.1
AB307717 mRNA Translation: BAH02308.1
BT007144 mRNA Translation: AAP35808.1
AK314437 mRNA Translation: BAG37048.1
CR456704 mRNA Translation: CAG32985.1
AC025259 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58222.1
CH471111 Genomic DNA Translation: EAW58224.1
CH471111 Genomic DNA Translation: EAW58225.1
BC016147 mRNA Translation: AAH16147.1
CCDSiCCDS55828.1 [P22736-2]
CCDS8818.1 [P22736-1]
PIRiA37251
RefSeqiNP_001189162.1, NM_001202233.1 [P22736-2]
NP_002126.2, NM_002135.4 [P22736-1]
NP_775180.1, NM_173157.2 [P22736-1]
XP_005268881.1, XM_005268824.3 [P22736-1]
XP_006719426.1, XM_006719363.1 [P22736-1]
XP_006719427.1, XM_006719364.3 [P22736-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QW4X-ray2.80A/B/C/D347-598[»]
3V3EX-ray2.06A/B351-598[»]
3V3QX-ray2.22A/B351-598[»]
4JGVX-ray3.01A/B351-598[»]
4KZIX-ray2.41A/B351-598[»]
4KZJX-ray2.12A/B351-598[»]
4KZMX-ray2.30A/B351-598[»]
4RE8X-ray2.16A/B351-598[»]
4REEX-ray2.37A/B351-598[»]
4REFX-ray2.10A/B351-598[»]
4RZEX-ray2.49A/B351-598[»]
4RZFX-ray1.99A/B351-598[»]
4RZGX-ray2.70A/B351-598[»]
4WHFX-ray2.27A/B351-598[»]
4WHGX-ray2.18A/B351-598[»]
6KZ5X-ray4.45A/B351-598[»]
6LC1X-ray3.12A/D/G/J265-351[»]
SMRiP22736
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi109407, 202 interactors
DIPiDIP-40392N
IntActiP22736, 111 interactors
MINTiP22736
STRINGi9606.ENSP00000440864

Chemistry databases

BindingDBiP22736
ChEMBLiCHEMBL1293229

Protein family/group databases

MoonDBiP22736, Predicted

PTM databases

GlyGeniP22736, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP22736
PhosphoSitePlusiP22736

Genetic variation databases

BioMutaiNR4A1
DMDMi127819

Proteomic databases

EPDiP22736
jPOSTiP22736
MassIVEiP22736
MaxQBiP22736
PaxDbiP22736
PeptideAtlasiP22736
PRIDEiP22736
ProteomicsDBi54032 [P22736-1]
54033 [P22736-2]
60662

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		14466, 719 antibodies from 45 providers

The DNASU plasmid repository

More...DNASUi		3164

Genome annotation databases

EnsembliENST00000243050; ENSP00000243050; ENSG00000123358
ENST00000360284; ENSP00000353427; ENSG00000123358 [P22736-2]
ENST00000394824; ENSP00000378301; ENSG00000123358
ENST00000394825; ENSP00000378302; ENSG00000123358
ENST00000548232; ENSP00000449587; ENSG00000123358 [P22736-3]
ENST00000550082; ENSP00000449539; ENSG00000123358 [P22736-2]
GeneIDi3164
KEGGihsa:3164
MANE-SelectiENST00000394825.6; ENSP00000378302.1; NM_173157.3; NP_775180.1
UCSCiuc001rzs.4, human [P22736-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3164
DisGeNETi3164

GeneCards: human genes, protein and diseases

More...GeneCardsi		NR4A1
HGNCiHGNC:7980, NR4A1
HPAiENSG00000123358, Low tissue specificity
MIMi139139, gene
neXtProtiNX_P22736
OpenTargetsiENSG00000123358
PharmGKBiPA31761
VEuPathDBiHostDB:ENSG00000123358

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4217, Eukaryota
GeneTreeiENSGT00950000183038
HOGENOMiCLU_007368_14_2_1
InParanoidiP22736
OMAiMEVIRKW
OrthoDBi454476at2759
PhylomeDBiP22736
TreeFamiTF315430

Enzyme and pathway databases

PathwayCommonsiP22736
ReactomeiR-HSA-198693, AKT phosphorylates targets in the nucleus
R-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-5674400, Constitutive Signaling by AKT1 E17K in Cancer
SignaLinkiP22736
SIGNORiP22736

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		3164, 10 hits in 1065 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NR4A1, human
EvolutionaryTraceiP22736

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Nerve_Growth_factor_IB

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3164
PharosiP22736, Tbio

Protein Ontology

More...PROi		PR:P22736
RNActiP22736, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000123358, Expressed in right adrenal gland and 236 other tissues
ExpressionAtlasiP22736, baseline and differential
GenevisibleiP22736, HS

Family and domain databases

Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500, NHR-like_dom_sf
IPR003071, Nuc_orp_HMR_rcpt
IPR003070, Nuc_orph_rcpt
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA
PfamiView protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit
PRINTSiPR01285, HMRNUCRECPTR
PR01284, NUCLEARECPTR
PR00398, STRDHORMONER
PR00047, STROIDFINGER
SMARTiView protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit
SUPFAMiSSF48508, SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNR4A1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P22736
Secondary accession number(s): B4DML7
, Q15627, Q53Y00, Q6IBU8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: August 1, 1991
Last modified: February 23, 2022
This is version 225 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again