Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 200 (12 Aug 2020)
Sequence version 3 (24 Jan 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NADPH:adrenodoxin oxidoreductase, mitochondrial

Gene

FDXR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serves as the first electron transfer protein in all the mitochondrial P450 systems including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADBy similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: cholesterol metabolism

This protein is involved in the pathway cholesterol metabolism, which is part of Steroid metabolism.By similarity
View all proteins of this organism that are known to be involved in the pathway cholesterol metabolism and in Steroid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei49FAD; via amide nitrogenBy similarity1
Binding sitei69FADBy similarity1
Binding sitei77FAD; via amide nitrogenBy similarity1
Binding sitei113FAD; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei240NADPBy similarity1
Binding sitei398FAD; via amide nitrogenBy similarity1
Binding sitei405NADP; via amide nitrogenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi184 – 187NADPBy similarity4
Nucleotide bindingi228 – 229NADPBy similarity2
Nucleotide bindingi405 – 407FADBy similarity3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processCholesterol metabolism, Electron transport, Lipid metabolism, Steroid metabolism, Sterol metabolism, Transport
LigandFAD, Flavoprotein, NADP

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS08587-MONOMER

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P22570

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-196108, Pregnenolone biosynthesis
R-HSA-211976, Endogenous sterols
R-HSA-2395516, Electron transport from NADPH to Ferredoxin
R-HSA-5579026, Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00296

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADPH:adrenodoxin oxidoreductase, mitochondrial (EC:1.18.1.6By similarity)
Short name:
AR
Short name:
Adrenodoxin reductase1 Publication
Alternative name(s):
Ferredoxin--NADP(+) reductase
Short name:
Ferredoxin reductase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FDXRImported
Synonyms:ADXR
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000161513.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3642, FDXR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
103270, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P22570

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Auditory neuropathy and optic atrophy (ANOA)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disease characterized by hearing loss, visual impairment and optic atrophy, with onset in the first or second decades of life. Optic atrophy is caused by degeneration of nerve fibers which arise in the retina and converge to form the optic disk, optic nerve, optic chiasm and optic tracts.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_080376215L → V in ANOA. 1 Publication1
Natural variantiVAR_080377242R → W in ANOA. 1 Publication1
Natural variantiVAR_080378306R → C in ANOA. 1 Publication1
Natural variantiVAR_080379327R → S in ANOA. 1 Publication1
Natural variantiVAR_080380419 – 491Missing in ANOA. 1 PublicationAdd BLAST73

Keywords - Diseasei

Deafness, Disease mutation, Neuropathy

Organism-specific databases

DisGeNET

More...
DisGeNETi
2232

MalaCards human disease database

More...
MalaCardsi
FDXR
MIMi617717, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000161513

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
542585, Auditory neuropathy-optic atrophy syndrome
543470, Optic atrophy-ataxia-peripheral neuropathy-global developmental delay syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28086

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P22570, Tbio

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB03147, Flavin adenine dinucleotide
DB03461, Nicotinamide adenine dinucleotide phosphate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FDXR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
85681283

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 32MitochondrionBy similarityAdd BLAST32
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001942033 – 491NADPH:adrenodoxin oxidoreductase, mitochondrialAdd BLAST459

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei310PhosphoserineCombined sources1
Modified residuei317PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P22570

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P22570

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P22570

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P22570

PeptideAtlas

More...
PeptideAtlasi
P22570

PRoteomics IDEntifications database

More...
PRIDEi
P22570

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
17542
4256
4894
54003 [P22570-1]
54004 [P22570-2]
6867

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00026958

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P22570

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P22570

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000161513, Expressed in left adrenal gland and 168 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P22570, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P22570, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000161513, Tissue enhanced (adrenal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

Interacts directly with FDX1.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
108523, 40 interactors

Protein interaction database and analysis system

More...
IntActi
P22570, 21 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000416515

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P22570, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P22570

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1800, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013574

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_024722_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P22570

KEGG Orthology (KO)

More...
KOi
K18914

Database of Orthologous Groups

More...
OrthoDBi
1324510at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P22570

TreeFam database of animal gene trees

More...
TreeFami
TF314193

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.50.50.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036188, FAD/NAD-bd_sf
IPR023753, FAD/NAD-binding_dom
IPR021163, Ferredox_Rdtase_adrenod

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07992, Pyr_redox_2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000362, FNR, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51905, SSF51905, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform Short (identifier: P22570-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASRCWRWWG WSAWPRTRLP PAGSTPSFCH HFSTQEKTPQ ICVVGSGPAG
60 70 80 90 100
FYTAQHLLKH PQAHVDIYEK QPVPFGLVRF GVAPDHPEVK NVINTFTQTA
110 120 130 140 150
HSGRCAFWGN VEVGRDVTVP ELREAYHAVV LSYGAEDHRA LEIPGEELPG
160 170 180 190 200
VCSARAFVGW YNGLPENQEL EPDLSCDTAV ILGQGNVALD VARILLTPPE
210 220 230 240 250
HLERTDITKA ALGVLRQSRV KTVWLVGRRG PLQVAFTIKE LREMIQLPGA
260 270 280 290 300
RPILDPVDFL GLQDKIKEVP RPRKRLTELL LRTATEKPGP AEAARQASAS
310 320 330 340 350
RAWGLRFFRS PQQVLPSPDG RRAAGVRLAV TRLEGVDEAT RAVPTGDMED
360 370 380 390 400
LPCGLVLSSI GYKSRPVDPS VPFDSKLGVI PNVEGRVMDV PGLYCSGWVK
410 420 430 440 450
RGPTGVIATT MTDSFLTGQM LLQDLKAGLL PSGPRPGYAA IQALLSSRGV
460 470 480 490
RPVSFSDWEK LDAEEVARGQ GTGKPREKLV DPQEMLRLLG H
Length:491
Mass (Da):53,837
Last modified:January 24, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i15D07E714F592C9D
GO
Isoform Long (identifier: P22570-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     203-203: E → EALLLCQ

Note: Represents 10-20% of all adrenodoxin reductase mRNAs and seems to be inactive.Curated
Show »
Length:497
Mass (Da):54,479
Checksum:i08C3D3F2C86564DA
GO
Isoform 3 (identifier: P22570-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: K → KRVEALCSQPRVLNSPALSGEGEDLGASQPLSLDPTSCHPVPQQ

Show »
Length:534
Mass (Da):58,304
Checksum:i755B0612AAD29612
GO
Isoform 4 (identifier: P22570-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLK → MEDKDRE

Show »
Length:439
Mass (Da):48,056
Checksum:i20D88F1A91909900
GO
Isoform 5 (identifier: P22570-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-98: Missing.

Show »
Length:483
Mass (Da):52,919
Checksum:i8AD11CAC35C3E4C1
GO
Isoform 6 (identifier: P22570-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: K → KQ
     91-131: Missing.

Show »
Length:451
Mass (Da):49,425
Checksum:i367CE00CA673D9E2
GO
Isoform 7 (identifier: P22570-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-34: SFCHHFST → TFGGSDEVRDPANAKALRNKRRRMQVRVKLGKFQLLLDI

Show »
Length:522
Mass (Da):57,370
Checksum:i1D82107E5C08C814
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DFN8A0A0C4DFN8_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
491Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSZ4A0A0A0MSZ4_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
522Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGN7A0A0C4DGN7_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
497Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QQX3J3QQX3_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
463Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT64A0A0A0MT64_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
534Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTN9A0A0A0MTN9_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
439Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTR6A0A0A0MTR6_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
483Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRG8J3KRG8_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTA3J3KTA3_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QQW7J3QQW7_HUMAN
NADPH:adrenodoxin oxidoreductase, m...
FDXR
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti223V → G in BAG56748 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0251927R → L1 PublicationCorresponds to variant dbSNP:rs28365947Ensembl.1
Natural variantiVAR_004624123R → Q3 PublicationsCorresponds to variant dbSNP:rs690514Ensembl.1
Natural variantiVAR_025193213G → V1 PublicationCorresponds to variant dbSNP:rs35692345Ensembl.1
Natural variantiVAR_080376215L → V in ANOA. 1 Publication1
Natural variantiVAR_080377242R → W in ANOA. 1 Publication1
Natural variantiVAR_025194248P → L1 PublicationCorresponds to variant dbSNP:rs35072974Ensembl.1
Natural variantiVAR_025195251R → W1 PublicationCorresponds to variant dbSNP:rs34038065Ensembl.1
Natural variantiVAR_025196301R → C1 PublicationCorresponds to variant dbSNP:rs34118765Ensembl.1
Natural variantiVAR_080378306R → C in ANOA. 1 Publication1
Natural variantiVAR_080379327R → S in ANOA. 1 Publication1
Natural variantiVAR_025197345T → M1 PublicationCorresponds to variant dbSNP:rs35660143Ensembl.1
Natural variantiVAR_025198352P → S1 PublicationCorresponds to variant dbSNP:rs35696549Ensembl.1
Natural variantiVAR_080380419 – 491Missing in ANOA. 1 PublicationAdd BLAST73
Natural variantiVAR_025199472T → A1 PublicationCorresponds to variant dbSNP:rs35769464Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0466691 – 59MASRC…QHLLK → MEDKDRE in isoform 4. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_04667027 – 34SFCHHFST → TFGGSDEVRDPANAKALRNK RRRMQVRVKLGKFQLLLDI in isoform 7. 1 Publication8
Alternative sequenceiVSP_04513559K → KRVEALCSQPRVLNSPALSG EGEDLGASQPLSLDPTSCHP VPQQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_04667159K → KQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_04667291 – 131Missing in isoform 6. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_04667391 – 98Missing in isoform 5. 1 Publication8
Alternative sequenceiVSP_003416203E → EALLLCQ in isoform Long. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
J03826 mRNA Translation: AAB59498.1
J03826 mRNA Translation: AAB59497.1
M58509, M58508 Genomic DNA Translation: AAA51668.1
M58509, M58508 Genomic DNA Translation: AAA51669.1
DQ085780 Genomic DNA Translation: AAY68215.1
AK293208 mRNA Translation: BAG56748.1
AK295307 mRNA Translation: BAG58287.1
AK298908 mRNA Translation: BAG61016.1
AK301779 mRNA Translation: BAG63236.1
AK301977 mRNA Translation: BAH13598.1
AC068874 Genomic DNA No translation available.
BC002960 mRNA Translation: AAH02960.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11707.1 [P22570-2]
CCDS58591.1 [P22570-4]
CCDS58592.1 [P22570-5]
CCDS58593.1 [P22570-1]
CCDS58594.1 [P22570-6]
CCDS58595.1 [P22570-3]
CCDS58596.1 [P22570-7]

Protein sequence database of the Protein Information Resource

More...
PIRi
A40487

NCBI Reference Sequences

More...
RefSeqi
NP_001244941.2, NM_001258012.3
NP_001244942.2, NM_001258013.3
NP_001244943.2, NM_001258014.3
NP_001244944.1, NM_001258015.2 [P22570-6]
NP_001244945.2, NM_001258016.3
NP_004101.3, NM_004110.5
NP_077728.3, NM_024417.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000420580; ENSP00000414172; ENSG00000161513 [P22570-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2232

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2232

UCSC genome browser

More...
UCSCi
uc002jlx.4, human [P22570-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03826 mRNA Translation: AAB59498.1
J03826 mRNA Translation: AAB59497.1
M58509, M58508 Genomic DNA Translation: AAA51668.1
M58509, M58508 Genomic DNA Translation: AAA51669.1
DQ085780 Genomic DNA Translation: AAY68215.1
AK293208 mRNA Translation: BAG56748.1
AK295307 mRNA Translation: BAG58287.1
AK298908 mRNA Translation: BAG61016.1
AK301779 mRNA Translation: BAG63236.1
AK301977 mRNA Translation: BAH13598.1
AC068874 Genomic DNA No translation available.
BC002960 mRNA Translation: AAH02960.1
CCDSiCCDS11707.1 [P22570-2]
CCDS58591.1 [P22570-4]
CCDS58592.1 [P22570-5]
CCDS58593.1 [P22570-1]
CCDS58594.1 [P22570-6]
CCDS58595.1 [P22570-3]
CCDS58596.1 [P22570-7]
PIRiA40487
RefSeqiNP_001244941.2, NM_001258012.3
NP_001244942.2, NM_001258013.3
NP_001244943.2, NM_001258014.3
NP_001244944.1, NM_001258015.2 [P22570-6]
NP_001244945.2, NM_001258016.3
NP_004101.3, NM_004110.5
NP_077728.3, NM_024417.4

3D structure databases

SMRiP22570
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi108523, 40 interactors
IntActiP22570, 21 interactors
STRINGi9606.ENSP00000416515

Chemistry databases

DrugBankiDB03147, Flavin adenine dinucleotide
DB03461, Nicotinamide adenine dinucleotide phosphate

PTM databases

iPTMnetiP22570
PhosphoSitePlusiP22570

Polymorphism and mutation databases

BioMutaiFDXR
DMDMi85681283

2D gel databases

REPRODUCTION-2DPAGEiIPI00026958

Proteomic databases

EPDiP22570
jPOSTiP22570
MassIVEiP22570
PaxDbiP22570
PeptideAtlasiP22570
PRIDEiP22570
ProteomicsDBi17542
4256
4894
54003 [P22570-1]
54004 [P22570-2]
6867

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3261, 273 antibodies

The DNASU plasmid repository

More...
DNASUi
2232

Genome annotation databases

EnsembliENST00000420580; ENSP00000414172; ENSG00000161513 [P22570-6]
GeneIDi2232
KEGGihsa:2232
UCSCiuc002jlx.4, human [P22570-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2232
DisGeNETi2232
EuPathDBiHostDB:ENSG00000161513.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FDXR
HGNCiHGNC:3642, FDXR
HPAiENSG00000161513, Tissue enhanced (adrenal)
MalaCardsiFDXR
MIMi103270, gene
617717, phenotype
neXtProtiNX_P22570
OpenTargetsiENSG00000161513
Orphaneti542585, Auditory neuropathy-optic atrophy syndrome
543470, Optic atrophy-ataxia-peripheral neuropathy-global developmental delay syndrome
PharmGKBiPA28086

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1800, Eukaryota
GeneTreeiENSGT00390000013574
HOGENOMiCLU_024722_3_1_1
InParanoidiP22570
KOiK18914
OrthoDBi1324510at2759
PhylomeDBiP22570
TreeFamiTF314193

Enzyme and pathway databases

UniPathwayiUPA00296
BioCyciMetaCyc:HS08587-MONOMER
PathwayCommonsiP22570
ReactomeiR-HSA-196108, Pregnenolone biosynthesis
R-HSA-211976, Endogenous sterols
R-HSA-2395516, Electron transport from NADPH to Ferredoxin
R-HSA-5579026, Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
2232, 414 hits in 883 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Adrenodoxin_reductase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2232
PharosiP22570, Tbio

Protein Ontology

More...
PROi
PR:P22570
RNActiP22570, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000161513, Expressed in left adrenal gland and 168 other tissues
ExpressionAtlasiP22570, baseline and differential
GenevisibleiP22570, HS

Family and domain databases

Gene3Di3.50.50.60, 1 hit
InterProiView protein in InterPro
IPR036188, FAD/NAD-bd_sf
IPR023753, FAD/NAD-binding_dom
IPR021163, Ferredox_Rdtase_adrenod
PfamiView protein in Pfam
PF07992, Pyr_redox_2, 1 hit
PIRSFiPIRSF000362, FNR, 1 hit
SUPFAMiSSF51905, SSF51905, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADRO_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P22570
Secondary accession number(s): B4DDI7
, B4DHX5, B4DQQ4, B4DX24, B7Z7G2, E7EQC1, Q13716, Q4PJI0, Q9BU12
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: January 24, 2006
Last modified: August 12, 2020
This is version 200 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again