UniProtKB - P22452 (RL39_HALMA)

BLAST

>sp|P22452|RL39_HALMA 50S ribosomal protein L39e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl39e PE=1 SV=2
MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE

Align
Format
Add to basket Added to basket
History
Entry version 125 (10 Oct 2018)
Sequence version 2 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L39e

Gene

rpl39e

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Binds to the 23S rRNA. Forms part of the polypeptide exit tunnel.

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-KW
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L39e Alternative name(s): Hl39e Hl46e
Gene namesⁱ	Name:rpl39e Ordered Locus Names:rrnAC3112
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed1 Publication
ChainⁱPRO_0000127047	2 – 50	50S ribosomal protein L39eAdd BLAST		49

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Interacts weakly with protein L23.2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC3112

STRINGⁱ

272569.rrnAC3112

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	6 – 18	Combined sources	13
Helixⁱ	24 – 29	Combined sources	6
Turnⁱ	30 – 32	Combined sources	3
Turnⁱ	43 – 45	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P22452
SMRⁱ	P22452
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P22452

EvolutionaryTraceⁱ

P22452

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the eukaryotic ribosomal protein eL39 family.Curated

Phylogenomic databases

eggNOGⁱ	arCOG04177 Archaea COG2167 LUCA
HOGENOMⁱ	HOG000230627
KEGG Orthology (KO) More...KOⁱ	K02924
OMAⁱ	MTHPKRR
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0N59

Family and domain databases

Gene3Dⁱ	1.10.1620.10, 1 hit
HAMAPⁱ	MF_00629 Ribosomal_L39e, 1 hit
InterProⁱ	View protein in InterPro IPR000077 Ribosomal_L39 IPR020083 Ribosomal_L39_CS IPR023626 Ribosomal_L39e_dom_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00832 Ribosomal_L39, 1 hit
SUPFAMⁱ	SSF48662 SSF48662, 1 hit
PROSITEⁱ	View protein in PROSITE PS00051 RIBOSOMAL_L39E, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P22452-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MGKKSKATKK RLAKLDNQNS RVPAWVMLKT DREVQRNHKR RHWRRNDTDE

Length:50

Mass (Da):6,115

Last modified:January 23, 2007 - v2

Checksum:ⁱ4999D410AB7B331A

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X55007 Genomic DNA Translation: CAA38750.1 AY596297 Genomic DNA Translation: AAV47823.1
PIRⁱ	S13066 R6HS39
NCBI Reference Sequences More...RefSeqⁱ	WP_004518346.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV47823; AAV47823; rrnAC3112
GeneIDⁱ	35218992
KEGGⁱ	hma:rrnAC3112
PATRICⁱ	fig\|272569.17.peg.3654

Protein	Similar proteins		Species	Score	Length	Source
P22452	50S ribosomal protein L39e		Haloarcula amylolytica JCM 13557		50	UniRef100_P22452
50S ribosomal protein L39e		HALHT		50
50S ribosomal protein L39e		Haloarcula hispanica N601		50
50S ribosomal protein L39e		Haloarcula vallismortis ATCC 29715		50
50S ribosomal protein L39e		HALVA		50
+8

Protein	Similar proteins		Species	Score	Length	Source
P22452	50S ribosomal protein L39e		Haloarcula amylolytica JCM 13557		50	UniRef90_P22452
50S ribosomal protein L39e		HALHT		50
50S ribosomal protein L39e		Haloarcula hispanica N601		50
50S ribosomal protein L39e		Haloarcula vallismortis ATCC 29715		50
50S ribosomal protein L39e		HALVA		50
+8

Protein	Similar proteins		Species	Score	Length	Source
P22452	50S ribosomal protein L39e		METBU		51	UniRef50_P22452
50S ribosomal protein L39e		METMJ		50
50S ribosomal protein L39e		HALS3		50
50S ribosomal protein L39e		HALSA		50
50S ribosomal protein L39e		METTH		51
+424

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X55007 Genomic DNA Translation: CAA38750.1 AY596297 Genomic DNA Translation: AAV47823.1
PIRⁱ	S13066 R6HS39
RefSeqⁱ	WP_004518346.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	Y	2-50	[»]
	1JJ2	X-ray	2.40	1	2-49	[»]
	1K73	X-ray	3.01	3	2-49	[»]
	1K8A	X-ray	3.00	3	2-49	[»]
	1K9M	X-ray	3.00	3	2-49	[»]
	1KC8	X-ray	3.01	3	2-49	[»]
	1KD1	X-ray	3.00	3	2-49	[»]
	1KQS	X-ray	3.10	1	2-49	[»]
	1M1K	X-ray	3.20	3	2-49	[»]
	1M90	X-ray	2.80	3	2-49	[»]
	1N8R	X-ray	3.00	3	2-49	[»]
	1NJI	X-ray	3.00	3	2-49	[»]
	1Q7Y	X-ray	3.20	3	2-49	[»]
	1Q81	X-ray	2.95	3	2-49	[»]
	1Q82	X-ray	2.98	3	2-49	[»]
	1Q86	X-ray	3.00	3	2-49	[»]
	1QVF	X-ray	3.10	1	2-49	[»]
	1QVG	X-ray	2.90	1	2-49	[»]
	1S72	X-ray	2.40	2	1-50	[»]
	1VQ4	X-ray	2.70	2	1-50	[»]
	1VQ5	X-ray	2.60	2	1-50	[»]
	1VQ6	X-ray	2.70	2	1-50	[»]
	1VQ7	X-ray	2.50	2	1-50	[»]
	1VQ8	X-ray	2.20	2	1-50	[»]
	1VQ9	X-ray	2.40	2	1-50	[»]
	1VQK	X-ray	2.30	2	1-50	[»]
	1VQL	X-ray	2.30	2	1-50	[»]
	1VQM	X-ray	2.30	2	1-50	[»]
	1VQN	X-ray	2.40	2	1-50	[»]
	1VQO	X-ray	2.20	2	1-50	[»]
	1VQP	X-ray	2.25	2	1-50	[»]
	1W2B	X-ray	3.50	1	2-49	[»]
	1YHQ	X-ray	2.40	2	1-50	[»]
	1YI2	X-ray	2.65	2	1-50	[»]
	1YIJ	X-ray	2.60	2	1-50	[»]
	1YIT	X-ray	2.80	2	1-50	[»]
	1YJ9	X-ray	2.90	2	1-50	[»]
	1YJN	X-ray	3.00	2	1-50	[»]
	1YJW	X-ray	2.90	2	1-50	[»]
	2OTJ	X-ray	2.90	2	1-50	[»]
	2OTL	X-ray	2.70	2	1-50	[»]
	2QA4	X-ray	3.00	2	1-50	[»]
	2QEX	X-ray	2.90	2	1-50	[»]
	3CC2	X-ray	2.40	2	1-50	[»]
	3CC4	X-ray	2.70	2	1-50	[»]
	3CC7	X-ray	2.70	2	1-50	[»]
	3CCE	X-ray	2.75	2	1-50	[»]
	3CCJ	X-ray	2.70	2	1-50	[»]
	3CCL	X-ray	2.90	2	1-50	[»]
	3CCM	X-ray	2.55	2	1-50	[»]
	3CCQ	X-ray	2.90	2	1-50	[»]
	3CCR	X-ray	3.00	2	1-50	[»]
	3CCS	X-ray	2.95	2	1-50	[»]
	3CCU	X-ray	2.80	2	1-50	[»]
	3CCV	X-ray	2.90	2	1-50	[»]
	3CD6	X-ray	2.75	2	1-50	[»]
	3CMA	X-ray	2.80	2	1-50	[»]
	3CME	X-ray	2.95	2	1-50	[»]
	3CPW	X-ray	2.70	1	1-50	[»]
	3CXC	X-ray	3.00	1	2-50	[»]
	3G4S	X-ray	3.20	2	1-50	[»]
	3G6E	X-ray	2.70	2	1-50	[»]
	3G71	X-ray	2.85	2	1-50	[»]
3I55	X-ray	3.11	2	1-50	[»]
3I56	X-ray	2.90	2	1-50	[»]
3OW2	X-ray	2.70	1	2-50	[»]
4ADX	electron microscopy	6.60	2	1-50	[»]
4V9F	X-ray	2.40	2	1-50	[»]
ProteinModelPortalⁱ	P22452
SMRⁱ	P22452
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC3112

STRINGⁱ

272569.rrnAC3112

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV47823; AAV47823; rrnAC3112
GeneIDⁱ	35218992
KEGGⁱ	hma:rrnAC3112
PATRICⁱ	fig\|272569.17.peg.3654

Phylogenomic databases

eggNOGⁱ	arCOG04177 Archaea COG2167 LUCA
HOGENOMⁱ	HOG000230627
KOⁱ	K02924
OMAⁱ	MTHPKRR
OrthoDBⁱ	POG093Z0N59

Miscellaneous databases

EvolutionaryTraceⁱ	P22452

EvolutionaryTraceⁱ

P22452

Family and domain databases

Gene3Dⁱ	1.10.1620.10, 1 hit
HAMAPⁱ	MF_00629 Ribosomal_L39e, 1 hit
InterProⁱ	View protein in InterPro IPR000077 Ribosomal_L39 IPR020083 Ribosomal_L39_CS IPR023626 Ribosomal_L39e_dom_sf
Pfamⁱ	View protein in Pfam PF00832 Ribosomal_L39, 1 hit
SUPFAMⁱ	SSF48662 SSF48662, 1 hit
PROSITEⁱ	View protein in PROSITE PS00051 RIBOSOMAL_L39E, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL39_HALMA
Accessionⁱ	P22452Primary (citable) accession number: P22452 Secondary accession number(s): Q5UY30
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 1, 1991
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 125 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P22452 (RL39_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L39e

rpl39e

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ