UniProtKB - P22450 (RL14_HALMA)

BLAST

>sp|P22450|RL14_HALMA 50S ribosomal protein L14 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl14 PE=1 SV=1
MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKG
TPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQR
FGSVASAATMIV

Align
Format
Add to basket Added to basket
History
Entry version 125 (10 Oct 2018)
Sequence version 1 (01 Aug 1991)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L14

Gene

rpl14

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Forms part of two intersubunit bridges in the 70S ribosome (By similarity). Binds to 23S rRNA.By similarity

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L14UniRule annotation Alternative name(s): Hl27 Hmal14
Gene namesⁱ	Name:rpl14UniRule annotation Ordered Locus Names:rrnAC1602
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000128571	1 – 132	50S ribosomal protein L14Add BLAST		132

Proteomic databases

PRIDEⁱ	P22450

PRIDEⁱ

P22450

Interactionⁱ

Subunit structureⁱ

The L3/L14/L24e cluster may contact the 16S rRNA in 2 intersubunit bridges (By similarity). Part of the 50S ribosomal subunit. Forms a cluster with proteins L3 and L24e.By similarity2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1602

STRINGⁱ

272569.rrnAC1602

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	5 – 8	Combined sources	4
Beta strandⁱ	17 – 20	Combined sources	4
Beta strandⁱ	22 – 34	Combined sources	13
Beta strandⁱ	52 – 60	Combined sources	9
Turnⁱ	62 – 66	Combined sources	5
Beta strandⁱ	68 – 75	Combined sources	8
Beta strandⁱ	87 – 92	Combined sources	6
Beta strandⁱ	94 – 98	Combined sources	5
Beta strandⁱ	100 – 102	Combined sources	3
Beta strandⁱ	104 – 107	Combined sources	4
Beta strandⁱ	111 – 114	Combined sources	4
Helixⁱ	115 – 120	Combined sources	6
Helixⁱ	122 – 125	Combined sources	4
Beta strandⁱ	129 – 132	Combined sources	4

Show more details

3D structure databases

ProteinModelPortalⁱ	P22450
SMRⁱ	P22450
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P22450

EvolutionaryTraceⁱ

P22450

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the universal ribosomal protein uL14 family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	arCOG04095 Archaea COG0093 LUCA
HOGENOMⁱ	HOG000183703
KEGG Orthology (KO) More...KOⁱ	K02874
OMAⁱ	IKGPVAR
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0E3J

Family and domain databases

Gene3Dⁱ	2.40.150.20, 1 hit
HAMAPⁱ	MF_01367 Ribosomal_L14, 1 hit
InterProⁱ	View protein in InterPro IPR036853 Ribosomal_L14_sf IPR000218 Ribosomal_L14P IPR019971 Ribosomal_L14P_arc IPR019972 Ribosomal_L14P_CS
PANTHERⁱ	PTHR11761 PTHR11761, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00238 Ribosomal_L14, 1 hit
SMARTⁱ	View protein in SMART SM01374 Ribosomal_L14, 1 hit
SUPFAMⁱ	SSF50193 SSF50193, 1 hit
TIGRFAMsⁱ	TIGR03673 uL14_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00049 RIBOSOMAL_L14, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P22450-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MEALGADVTQ GLEKGSLITC ADNTGARELK VISVHGYSGT KNRHPKAGLG 
        60         70         80         90        100
DKITVSVTKG TPEMRRQVLE AVVVRQRKPI RRPDGTRVKF EDNAAVIVDE 
       110        120        130 
NEDPRGTELK GPIAREVAQR FGSVASAATM IV

Length:132

Mass (Da):14,193

Last modified:August 1, 1991 - v1

Checksum:ⁱ536F9C4461B7EA87

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X55311 Genomic DNA Translation: CAA39018.1 AY596297 Genomic DNA Translation: AAV46519.1
PIRⁱ	S10734 R5HS14
NCBI Reference Sequences More...RefSeqⁱ	WP_004516961.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46519; AAV46519; rrnAC1602
GeneIDⁱ	35220734
KEGGⁱ	hma:rrnAC1602
PATRICⁱ	fig\|272569.17.peg.2291

Protein	Similar proteins		Species	Score	Length	Source
P22450	50S ribosomal protein L14		Haloarcula amylolytica JCM 13557		132	UniRef100_P22450
50S ribosomal protein L14		HALHT		132
50S ribosomal protein L14		Haloarcula hispanica N601		132
50S ribosomal protein L14		Haloarcula vallismortis ATCC 29715		132
50S ribosomal protein L14		HALVA		132
+8

Protein	Similar proteins		Species	Score	Length	Source
P22450	50S ribosomal protein L14		NATPD		132	UniRef90_P22450
50S ribosomal protein L14		Haloarcula amylolytica JCM 13557		132
50S ribosomal protein L14		HALHT		132
50S ribosomal protein L14		Haloarcula hispanica N601		132
50S ribosomal protein L14		Haloarcula vallismortis ATCC 29715		132
+40

Protein	Similar proteins		Species	Score	Length	Source
P22450	50S ribosomal protein L14		NATPD		132	UniRef50_P22450
50S ribosomal protein L14		IGNH4		137
50S ribosomal protein L14	)	PYRFU		141
50S ribosomal protein L14		THEKO		141
50S ribosomal protein L14		AERPE		140
+872

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X55311 Genomic DNA Translation: CAA39018.1 AY596297 Genomic DNA Translation: AAV46519.1
PIRⁱ	S10734 R5HS14
RefSeqⁱ	WP_004516961.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1C04	X-ray	5.00	D	71-85	[»]
	1FFK	X-ray	2.40	H	1-132	[»]
	1JJ2	X-ray	2.40	J	1-132	[»]
	1K73	X-ray	3.01	L	1-132	[»]
	1K8A	X-ray	3.00	L	1-132	[»]
	1K9M	X-ray	3.00	L	1-132	[»]
	1KC8	X-ray	3.01	L	1-132	[»]
	1KD1	X-ray	3.00	L	1-132	[»]
	1KQS	X-ray	3.10	J	1-132	[»]
	1M1K	X-ray	3.20	L	1-132	[»]
	1M90	X-ray	2.80	L	1-132	[»]
	1N8R	X-ray	3.00	L	1-132	[»]
	1NJI	X-ray	3.00	L	1-132	[»]
	1Q7Y	X-ray	3.20	L	1-132	[»]
	1Q81	X-ray	2.95	L	1-132	[»]
	1Q82	X-ray	2.98	L	1-132	[»]
	1Q86	X-ray	3.00	L	1-132	[»]
	1QVF	X-ray	3.10	J	1-132	[»]
	1QVG	X-ray	2.90	J	1-132	[»]
	1S72	X-ray	2.40	K	1-132	[»]
	1VQ4	X-ray	2.70	K	1-132	[»]
	1VQ5	X-ray	2.60	K	1-132	[»]
	1VQ6	X-ray	2.70	K	1-132	[»]
	1VQ7	X-ray	2.50	K	1-132	[»]
	1VQ8	X-ray	2.20	K	1-132	[»]
	1VQ9	X-ray	2.40	K	1-132	[»]
	1VQK	X-ray	2.30	K	1-132	[»]
	1VQL	X-ray	2.30	K	1-132	[»]
	1VQM	X-ray	2.30	K	1-132	[»]
	1VQN	X-ray	2.40	K	1-132	[»]
	1VQO	X-ray	2.20	K	1-132	[»]
	1VQP	X-ray	2.25	K	1-132	[»]
	1W2B	X-ray	3.50	J	1-132	[»]
	1YHQ	X-ray	2.40	K	1-132	[»]
	1YI2	X-ray	2.65	K	1-132	[»]
	1YIJ	X-ray	2.60	K	1-132	[»]
	1YIT	X-ray	2.80	K	1-132	[»]
	1YJ9	X-ray	2.90	K	1-132	[»]
	1YJN	X-ray	3.00	K	1-132	[»]
	1YJW	X-ray	2.90	K	1-132	[»]
	2OTJ	X-ray	2.90	K	1-132	[»]
	2OTL	X-ray	2.70	K	1-132	[»]
	2QA4	X-ray	3.00	K	1-132	[»]
	2QEX	X-ray	2.90	K	1-132	[»]
	3CC2	X-ray	2.40	K	1-132	[»]
	3CC4	X-ray	2.70	K	1-132	[»]
	3CC7	X-ray	2.70	K	1-132	[»]
	3CCE	X-ray	2.75	K	1-132	[»]
	3CCJ	X-ray	2.70	K	1-132	[»]
	3CCL	X-ray	2.90	K	1-132	[»]
	3CCM	X-ray	2.55	K	1-132	[»]
	3CCQ	X-ray	2.90	K	1-132	[»]
	3CCR	X-ray	3.00	K	1-132	[»]
	3CCS	X-ray	2.95	K	1-132	[»]
	3CCU	X-ray	2.80	K	1-132	[»]
	3CCV	X-ray	2.90	K	1-132	[»]
	3CD6	X-ray	2.75	K	1-132	[»]
	3CMA	X-ray	2.80	K	1-132	[»]
	3CME	X-ray	2.95	K	1-132	[»]
	3CPW	X-ray	2.70	J	1-132	[»]
	3CXC	X-ray	3.00	J	1-132	[»]
	3G4S	X-ray	3.20	K	1-132	[»]
	3G6E	X-ray	2.70	K	1-132	[»]
3G71	X-ray	2.85	K	1-132	[»]
3I55	X-ray	3.11	K	1-132	[»]
3I56	X-ray	2.90	K	1-132	[»]
3OW2	X-ray	2.70	J	1-132	[»]
4ADX	electron microscopy	6.60	K	1-132	[»]
4V9F	X-ray	2.40	K	1-132	[»]
ProteinModelPortalⁱ	P22450
SMRⁱ	P22450
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1602

STRINGⁱ

272569.rrnAC1602

Proteomic databases

PRIDEⁱ	P22450

PRIDEⁱ

P22450

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46519; AAV46519; rrnAC1602
GeneIDⁱ	35220734
KEGGⁱ	hma:rrnAC1602
PATRICⁱ	fig\|272569.17.peg.2291

Phylogenomic databases

eggNOGⁱ	arCOG04095 Archaea COG0093 LUCA
HOGENOMⁱ	HOG000183703
KOⁱ	K02874
OMAⁱ	IKGPVAR
OrthoDBⁱ	POG093Z0E3J

Miscellaneous databases

EvolutionaryTraceⁱ	P22450

EvolutionaryTraceⁱ

P22450

Family and domain databases

Gene3Dⁱ	2.40.150.20, 1 hit
HAMAPⁱ	MF_01367 Ribosomal_L14, 1 hit
InterProⁱ	View protein in InterPro IPR036853 Ribosomal_L14_sf IPR000218 Ribosomal_L14P IPR019971 Ribosomal_L14P_arc IPR019972 Ribosomal_L14P_CS
PANTHERⁱ	PTHR11761 PTHR11761, 1 hit
Pfamⁱ	View protein in Pfam PF00238 Ribosomal_L14, 1 hit
SMARTⁱ	View protein in SMART SM01374 Ribosomal_L14, 1 hit
SUPFAMⁱ	SSF50193 SSF50193, 1 hit
TIGRFAMsⁱ	TIGR03673 uL14_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00049 RIBOSOMAL_L14, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL14_HALMA
Accessionⁱ	P22450Primary (citable) accession number: P22450 Secondary accession number(s): Q5V1T3
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 1, 1991
	Last sequence update:	August 1, 1991
	Last modified:	October 10, 2018
	This is version 125 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P22450 (RL14_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L14

rpl14

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ