Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lactadherin

Gene

Mfge8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction (By similarity). Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization.By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processAngiogenesis, Cell adhesion, Fertilization

Enzyme and pathway databases

ReactomeiR-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-8957275 Post-translational protein phosphorylation

Names & Taxonomyi

Protein namesi
Recommended name:
Lactadherin
Alternative name(s):
MFGM
Milk fat globule-EGF factor 8
Short name:
MFG-E8
SED1
Sperm surface protein SP47
Short name:
MP47
Gene namesi
Name:Mfge8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:102768 Mfge8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 221 PublicationAdd BLAST22
ChainiPRO_000000765323 – 463LactadherinAdd BLAST441

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi28 ↔ 39By similarity
Disulfide bondi33 ↔ 49By similarity
Disulfide bondi51 ↔ 60By similarity
Glycosylationi61N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi68 ↔ 79By similarity
Disulfide bondi73 ↔ 96By similarity
Disulfide bondi98 ↔ 107By similarity
Disulfide bondi148 ↔ 303By similarity
Glycosylationi266N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi290 ↔ 294By similarity
Disulfide bondi308 ↔ 4631 Publication
Glycosylationi316N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi426N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

N-glycosylated. Isoform 1 also exists in both an O-glycosylated and a non-O-glycosylated form.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP21956
PaxDbiP21956
PeptideAtlasiP21956
PRIDEiP21956

PTM databases

PhosphoSitePlusiP21956

Expressioni

Tissue specificityi

Mammary epithelial cell surfaces and spermatozoan. Isoform 2 is present in brain, heart, kidney and spleen and at low levels in lung, liver, small intestine and testis.2 Publications

Developmental stagei

Isoform 1 and isoform 2 are detectable in mammary tissue from non-pregnant animals, with isoform 2 being predominant. Levels of isoform 1 increase during gestation and lactation while levels of isoform 2 decrease.2 Publications

Inductioni

Isoform 1 is induced by insulin, prolactin and hydrocortisone in mammary epithelial cells. Expression of isoform 2 is repressed by the same treatment.1 Publication

Gene expression databases

BgeeiENSMUSG00000030605 Expressed in 310 organ(s), highest expression level in inguinal mammary gland
CleanExiMM_MFGE8
ExpressionAtlasiP21956 baseline and differential
GenevisibleiP21956 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

IntActiP21956, 1 interactor
MINTiP21956
STRINGi10090.ENSMUSP00000032825

Structurei

Secondary structure

1463
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP21956
SMRiP21956
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 61EGF-like 1PROSITE-ProRule annotationAdd BLAST38
Domaini64 – 108EGF-like 2PROSITE-ProRule annotationAdd BLAST45
Domaini148 – 303F5/8 type C 1PROSITE-ProRule annotationAdd BLAST156
Domaini308 – 463F5/8 type C 2PROSITE-ProRule annotationAdd BLAST156

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi87 – 89Cell attachment site3

Domaini

The F5/8 type C 2 domain mediates high-affinity binding to phosphatidylserine-containing membranes.

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IFBC Eukaryota
ENOG41114BV LUCA
GeneTreeiENSGT00910000143988
HOGENOMiHOG000236278
HOVERGENiHBG002385
InParanoidiP21956
KOiK17253
OMAiWYPFYAR
OrthoDBiEOG091G071G
TreeFamiTF330156

Family and domain databases

CDDicd00057 FA58C, 2 hits
Gene3Di2.60.120.260, 2 hits
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000421 FA58C
IPR008979 Galactose-bd-like_sf
IPR027060 Lactadherin
PANTHERiPTHR44122:SF1 PTHR44122:SF1, 1 hit
PfamiView protein in Pfam
PF00008 EGF, 2 hits
PF00754 F5_F8_type_C, 2 hits
SMARTiView protein in SMART
SM00181 EGF, 2 hits
SM00231 FA58C, 2 hits
SUPFAMiSSF49785 SSF49785, 2 hits
PROSITEiView protein in PROSITE
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 2 hits
PS50026 EGF_3, 2 hits
PS01285 FA58C_1, 2 hits
PS01286 FA58C_2, 2 hits
PS50022 FA58C_3, 2 hits

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P21956-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQVSRVLAAL CGMLLCASGL FAASGDFCDS SLCLNGGTCL TGQDNDIYCL
60 70 80 90 100
CPEGFTGLVC NETERGPCSP NPCYNDAKCL VTLDTQRGDI FTEYICQCPV
110 120 130 140 150
GYSGIHCETE TNYYNLDGEY MFTTAVPNTA VPTPAPTPDL SNNLASRCST
160 170 180 190 200
QLGMEGGAIA DSQISASSVY MGFMGLQRWG PELARLYRTG IVNAWTASNY
210 220 230 240 250
DSKPWIQVNL LRKMRVSGVM TQGASRAGRA EYLKTFKVAY SLDGRKFEFI
260 270 280 290 300
QDESGGDKEF LGNLDNNSLK VNMFNPTLEA QYIKLYPVSC HRGCTLRFEL
310 320 330 340 350
LGCELHGCSE PLGLKNNTIP DSQMSASSSY KTWNLRAFGW YPHLGRLDNQ
360 370 380 390 400
GKINAWTAQS NSAKEWLQVD LGTQRQVTGI ITQGARDFGH IQYVASYKVA
410 420 430 440 450
HSDDGVQWTV YEEQGSSKVF QGNLDNNSHK KNIFEKPFMA RYVRVLPVSW
460
HNRITLRLEL LGC
Length:463
Mass (Da):51,241
Last modified:July 27, 2011 - v3
Checksum:i6E19CBB494B22878
GO
Isoform 2 (identifier: P21956-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     110-147: ETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASR → G

Show »
Length:426
Mass (Da):47,169
Checksum:i0882EDA89B95C445
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RNV7A0A0U1RNV7_MOUSE
Lactadherin
Mfge8 mCG_6301
84Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti35N → D AA sequence (PubMed:2122462).Curated1
Sequence conflicti168S → Y in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti196T → H in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti284K → R in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti284K → R in CAA72380 (PubMed:9546740).Curated1
Sequence conflicti284K → R in BAA35180 (PubMed:9920772).Curated1
Sequence conflicti284K → R in BAA76386 (PubMed:9920772).Curated1
Sequence conflicti284K → R in BAC40794 (PubMed:16141072).Curated1
Sequence conflicti284K → R in BAE42274 (PubMed:16141072).Curated1
Sequence conflicti284K → R in AAH03892 (PubMed:15489334).Curated1
Sequence conflicti284K → R in AAH03904 (PubMed:15489334).Curated1
Sequence conflicti309S → L in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti395A → E in AAA39534 (PubMed:2122462).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009880110 – 147ETNYY…NLASR → G in isoform 2. 5 PublicationsAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M38337 mRNA Translation: AAA39534.1
Y11684 mRNA Translation: CAA72380.2
AB021130 mRNA Translation: BAA35180.1
AB025280 mRNA Translation: BAA76386.1
AK089211 mRNA Translation: BAC40794.1
AK152088 mRNA Translation: BAE30938.1
AK171143 mRNA Translation: BAE42274.1
BC003892 mRNA Translation: AAH03892.1
BC003904 mRNA Translation: AAH03904.1
CCDSiCCDS21379.1 [P21956-1]
CCDS39989.1 [P21956-2]
PIRiA36479
RefSeqiNP_032620.2, NM_008594.2 [P21956-1]
UniGeneiMm.1451

Genome annotation databases

EnsembliENSMUST00000032825; ENSMUSP00000032825; ENSMUSG00000030605 [P21956-1]
ENSMUST00000107409; ENSMUSP00000103032; ENSMUSG00000030605 [P21956-2]
GeneIDi17304
KEGGimmu:17304
UCSCiuc009hxz.1 mouse [P21956-1]
uc009hyb.1 mouse [P21956-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M38337 mRNA Translation: AAA39534.1
Y11684 mRNA Translation: CAA72380.2
AB021130 mRNA Translation: BAA35180.1
AB025280 mRNA Translation: BAA76386.1
AK089211 mRNA Translation: BAC40794.1
AK152088 mRNA Translation: BAE30938.1
AK171143 mRNA Translation: BAE42274.1
BC003892 mRNA Translation: AAH03892.1
BC003904 mRNA Translation: AAH03904.1
CCDSiCCDS21379.1 [P21956-1]
CCDS39989.1 [P21956-2]
PIRiA36479
RefSeqiNP_032620.2, NM_008594.2 [P21956-1]
UniGeneiMm.1451

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L9LNMR-A306-463[»]
ProteinModelPortaliP21956
SMRiP21956
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP21956, 1 interactor
MINTiP21956
STRINGi10090.ENSMUSP00000032825

PTM databases

PhosphoSitePlusiP21956

Proteomic databases

MaxQBiP21956
PaxDbiP21956
PeptideAtlasiP21956
PRIDEiP21956

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032825; ENSMUSP00000032825; ENSMUSG00000030605 [P21956-1]
ENSMUST00000107409; ENSMUSP00000103032; ENSMUSG00000030605 [P21956-2]
GeneIDi17304
KEGGimmu:17304
UCSCiuc009hxz.1 mouse [P21956-1]
uc009hyb.1 mouse [P21956-2]

Organism-specific databases

CTDi4240
MGIiMGI:102768 Mfge8

Phylogenomic databases

eggNOGiENOG410IFBC Eukaryota
ENOG41114BV LUCA
GeneTreeiENSGT00910000143988
HOGENOMiHOG000236278
HOVERGENiHBG002385
InParanoidiP21956
KOiK17253
OMAiWYPFYAR
OrthoDBiEOG091G071G
TreeFamiTF330156

Enzyme and pathway databases

ReactomeiR-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-8957275 Post-translational protein phosphorylation

Miscellaneous databases

ChiTaRSiMfge8 mouse
PROiPR:P21956
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030605 Expressed in 310 organ(s), highest expression level in inguinal mammary gland
CleanExiMM_MFGE8
ExpressionAtlasiP21956 baseline and differential
GenevisibleiP21956 MM

Family and domain databases

CDDicd00057 FA58C, 2 hits
Gene3Di2.60.120.260, 2 hits
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000421 FA58C
IPR008979 Galactose-bd-like_sf
IPR027060 Lactadherin
PANTHERiPTHR44122:SF1 PTHR44122:SF1, 1 hit
PfamiView protein in Pfam
PF00008 EGF, 2 hits
PF00754 F5_F8_type_C, 2 hits
SMARTiView protein in SMART
SM00181 EGF, 2 hits
SM00231 FA58C, 2 hits
SUPFAMiSSF49785 SSF49785, 2 hits
PROSITEiView protein in PROSITE
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 2 hits
PS50026 EGF_3, 2 hits
PS01285 FA58C_1, 2 hits
PS01286 FA58C_2, 2 hits
PS50022 FA58C_3, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiMFGM_MOUSE
AccessioniPrimary (citable) accession number: P21956
Secondary accession number(s): P97800
, Q3TBN5, Q3U8S9, Q9R1X9, Q9WTS3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: July 27, 2011
Last modified: November 7, 2018
This is version 155 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again