Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P21757 (MSRE_HUMAN)

Entry version 203 (02 Dec 2020)
Sequence version 1 (01 May 1991)
Previous versions | rss
Add a publicationFeedback
Protein

Macrophage scavenger receptor types I and II

Gene

MSR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL) (PubMed:2251254). Isoform III does not internalize acetylated LDL (PubMed:9548586).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processEndocytosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P21757

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3000480, Scavenging by Class A Receptors

SIGNOR Signaling Network Open Resource

More...SIGNORi		P21757

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Macrophage scavenger receptor types I and II
Alternative name(s):
Macrophage acetylated LDL receptor I and II
Scavenger receptor class A member 1
CD_antigen: CD204
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MSR1
Synonyms:SCARA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000038945.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:7376, MSR1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		153622, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P21757

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 50CytoplasmicSequence analysisAdd BLAST50
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei51 – 76Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST26
Topological domaini77 – 451ExtracellularSequence analysisAdd BLAST375

Keywords - Cellular componenti

LDL, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Prostate cancer (PC)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry. MSR1 variants may play a role in susceptibility to prostate cancer. MSR1 variants have been found in individuals with prostate cancer and co-segregate with the disease in some families.
Disease descriptionA malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
Related information in OMIM
Barrett esophagus (BE)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry. Genetic variants in MSR1 have been found in individuals with Barrett esophagus and are thought to contribute to disease susceptibility.
Disease descriptionA condition characterized by a metaplastic change in which normal esophageal squamous epithelium is replaced by a columnar and intestinal-type epithelium. Patients with Barrett esophagus have an increased risk of esophageal adenocarcinoma. The main cause of Barrett esophagus is gastroesophageal reflux. The retrograde movement of acid and bile salts from the stomach into the esophagus causes prolonged injury to the esophageal epithelium and induces chronic esophagitis, which in turn is believed to trigger the pathologic changes.
Related information in OMIM

Organism-specific databases

DisGeNET

More...DisGeNETi		4481

MalaCards human disease database

More...MalaCardsi		MSR1
MIMi176807, phenotype
614266, phenotype

Open Targets

More...OpenTargetsi		ENSG00000038945

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		1331, Familial prostate cancer
1232, NON RARE IN EUROPE: Barrett esophagus

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31181

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P21757, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5811

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MSR1

Domain mapping of disease mutations (DMDM)

More...DMDMi		127357

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001816271 – 451Macrophage scavenger receptor types I and IIAdd BLAST451

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi82N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi102N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi184N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi221N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi249N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi267N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi375 ↔ 439PROSITE-ProRule annotation1 Publication
Disulfide bondi388 ↔ 449PROSITE-ProRule annotation1 Publication
Disulfide bondi419 ↔ 429PROSITE-ProRule annotation1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P21757

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P21757

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P21757

PeptideAtlas

More...PeptideAtlasi		P21757

PRoteomics IDEntifications database

More...PRIDEi		P21757

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		53900 [P21757-1]
53901 [P21757-2]
53902 [P21757-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P21757, 7 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P21757

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P21757

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages. Isoform I and isoform II are expressed in the liver, placenta and brain.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000038945, Expressed in lung and 171 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P21757, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P21757, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000038945, Group enriched (adipose tissue, lung)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer (By similarity).

Interacts with MYO18A (PubMed:25965346).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110587, 12 interactors

Protein interaction database and analysis system

More...IntActi		P21757, 14 interactors

Molecular INTeraction database

More...MINTi		P21757

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000262101

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P21757

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P21757, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P21757

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini273 – 341Collagen-likeAdd BLAST69
Domaini350 – 450SRCRPROSITE-ProRule annotationAdd BLAST101

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni77 – 109SpacerCuratedAdd BLAST33

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili171 – 255Sequence analysisAdd BLAST85

Keywords - Domaini

Coiled coil, Collagen, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QUW0, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183074

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_041152_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P21757

Database of Orthologous Groups

More...OrthoDBi		900867at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P21757

TreeFam database of animal gene trees

More...TreeFami		TF330855

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.10.250.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008160, Collagen
IPR003543, Macro_scav_rcpt
IPR001190, SRCR
IPR017448, SRCR-like_dom
IPR036772, SRCR-like_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR19331:SF440, PTHR19331:SF440, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01391, Collagen, 1 hit
PF03523, Macscav_rec, 1 hit
PF00530, SRCR, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01408, MACSCAVRCPTR
PR00258, SPERACTRCPTR

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00202, SR, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56487, SSF56487, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00420, SRCR_1, 1 hit
PS50287, SRCR_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform I (identifier: P21757-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQWDHFHNQ QEDTDSCSES VKFDARSMTA LLPPNPKNSP SLQEKLKSFK 
        60         70         80         90        100
AALIALYLLV FAVLIPLIGI VAAQLLKWET KNCSVSSTNA NDITQSLTGK 
       110        120        130        140        150
GNDSEEEMRF QEVFMEHMSN MEKRIQHILD MEANLMDTEH FQNFSMTTDQ 
       160        170        180        190        200
RFNDILLQLS TLFSSVQGHG NAIDEISKSL ISLNTTLLDL QLNIENLNGK 
       210        220        230        240        250
IQENTFKQQE EISKLEERVY NVSAEIMAMK EEQVHLEQEI KGEVKVLNNI 
       260        270        280        290        300
TNDLRLKDWE HSQTLRNITL IQGPPGPPGE KGDRGPTGES GPRGFPGPIG 
       310        320        330        340        350
PPGLKGDRGA IGFPGSRGLP GYAGRPGNSG PKGQKGEKGS GNTLTPFTKV 
       360        370        380        390        400
RLVGGSGPHE GRVEILHSGQ WGTICDDRWE VRVGQVVCRS LGYPGVQAVH 
       410        420        430        440        450
KAAHFGQGTG PIWLNEVFCF GRESSIEECK IRQWGTRACS HSEDAGVTCT 

L
Length:451
Mass (Da):49,762
Last modified:May 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i915C03B56653BB41
GO
Isoform II (identifier: P21757-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-358: TPFTKVRLVGGSGP → RPVQLTDHIRAGPS
     359-451: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:358
Mass (Da):39,584
Checksum:i5F8593EF21189917
GO
Isoform III (identifier: P21757-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-408: TPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQG → S

Show »
Length:388
Mass (Da):42,942
Checksum:iD6A20BCE57BFBC46
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DDJ5B4DDJ5_HUMAN
Macrophage scavenger receptor types...
MSR1
469Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBY2H0YBY2_HUMAN
Macrophage scavenger receptor types...
MSR1
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFW8E5RFW8_HUMAN
Macrophage scavenger receptor types...
MSR1
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RI91E5RI91_HUMAN
Macrophage scavenger receptor types...
MSR1
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFI4E5RFI4_HUMAN
Macrophage scavenger receptor types...
MSR1
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02519023F → C1 PublicationCorresponds to variant dbSNP:rs35175081Ensembl.1
Natural variantiVAR_06658136P → A Found in a family with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs749666450Ensembl.1
Natural variantiVAR_06658241S → Y Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs145597376Ensembl.1
Natural variantiVAR_066583113V → A Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs117359034EnsemblClinVar.1
Natural variantiVAR_066584174D → Y Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs72552387EnsemblClinVar.1
Natural variantiVAR_066585254L → V Found in patients with Barrett esophagus. 1 PublicationCorresponds to variant dbSNP:rs387906645EnsemblClinVar.1
Natural variantiVAR_052061269T → I. Corresponds to variant dbSNP:rs13306543Ensembl.1
Natural variantiVAR_025191275P → A2 PublicationsCorresponds to variant dbSNP:rs2229388Ensembl.1
Natural variantiVAR_066586369G → S Found in a family with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs776370129Ensembl.1
Natural variantiVAR_066587441H → R Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs138749399Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_036842345 – 408TPFTK…HFGQG → S in isoform III. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_006229345 – 358TPFTK…GGSGP → RPVQLTDHIRAGPS in isoform II. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_006230359 – 451Missing in isoform II. 1 PublicationAdd BLAST93

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D90187 mRNA Translation: BAA14208.1
D90188 mRNA Translation: BAA14209.1
AF037351 mRNA Translation: AAC09251.1
DQ144993 Genomic DNA Translation: AAZ38715.1
AC023396 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63832.1
CH471080 Genomic DNA Translation: EAW63830.1
CH471080 Genomic DNA Translation: EAW63833.1
CH471080 Genomic DNA Translation: EAW63834.1
BC063878 mRNA Translation: AAH63878.1
D13263 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5995.1 [P21757-1]
CCDS5996.1 [P21757-3]
CCDS5997.1 [P21757-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A38415
B38415

NCBI Reference Sequences

More...RefSeqi		NP_002436.1, NM_002445.3 [P21757-2]
NP_619729.1, NM_138715.2 [P21757-1]
NP_619730.1, NM_138716.2 [P21757-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000262101; ENSP00000262101; ENSG00000038945 [P21757-1]
ENST00000350896; ENSP00000262100; ENSG00000038945 [P21757-3]
ENST00000355282; ENSP00000347430; ENSG00000038945 [P21757-3]
ENST00000381998; ENSP00000371428; ENSG00000038945 [P21757-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4481

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4481

UCSC genome browser

More...UCSCi		uc003wwz.4, human [P21757-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90187 mRNA Translation: BAA14208.1
D90188 mRNA Translation: BAA14209.1
AF037351 mRNA Translation: AAC09251.1
DQ144993 Genomic DNA Translation: AAZ38715.1
AC023396 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63832.1
CH471080 Genomic DNA Translation: EAW63830.1
CH471080 Genomic DNA Translation: EAW63833.1
CH471080 Genomic DNA Translation: EAW63834.1
BC063878 mRNA Translation: AAH63878.1
D13263 Genomic DNA No translation available.
CCDSiCCDS5995.1 [P21757-1]
CCDS5996.1 [P21757-3]
CCDS5997.1 [P21757-2]
PIRiA38415
B38415
RefSeqiNP_002436.1, NM_002445.3 [P21757-2]
NP_619729.1, NM_138715.2 [P21757-1]
NP_619730.1, NM_138716.2 [P21757-3]

3D structure databases

SMRiP21757
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi110587, 12 interactors
IntActiP21757, 14 interactors
MINTiP21757
STRINGi9606.ENSP00000262101

Chemistry databases

BindingDBiP21757
ChEMBLiCHEMBL5811

PTM databases

GlyGeniP21757, 7 sites
iPTMnetiP21757
PhosphoSitePlusiP21757

Polymorphism and mutation databases

BioMutaiMSR1
DMDMi127357

Proteomic databases

jPOSTiP21757
MassIVEiP21757
PaxDbiP21757
PeptideAtlasiP21757
PRIDEiP21757
ProteomicsDBi53900 [P21757-1]
53901 [P21757-2]
53902 [P21757-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		601, 903 antibodies

The DNASU plasmid repository

More...DNASUi		4481

Genome annotation databases

EnsembliENST00000262101; ENSP00000262101; ENSG00000038945 [P21757-1]
ENST00000350896; ENSP00000262100; ENSG00000038945 [P21757-3]
ENST00000355282; ENSP00000347430; ENSG00000038945 [P21757-3]
ENST00000381998; ENSP00000371428; ENSG00000038945 [P21757-2]
GeneIDi4481
KEGGihsa:4481
UCSCiuc003wwz.4, human [P21757-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4481
DisGeNETi4481
EuPathDBiHostDB:ENSG00000038945.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		MSR1
HGNCiHGNC:7376, MSR1
HPAiENSG00000038945, Group enriched (adipose tissue, lung)
MalaCardsiMSR1
MIMi153622, gene
176807, phenotype
614266, phenotype
neXtProtiNX_P21757
OpenTargetsiENSG00000038945
Orphaneti1331, Familial prostate cancer
1232, NON RARE IN EUROPE: Barrett esophagus
PharmGKBiPA31181

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QUW0, Eukaryota
GeneTreeiENSGT00950000183074
HOGENOMiCLU_041152_2_0_1
InParanoidiP21757
OrthoDBi900867at2759
PhylomeDBiP21757
TreeFamiTF330855

Enzyme and pathway databases

PathwayCommonsiP21757
ReactomeiR-HSA-3000480, Scavenging by Class A Receptors
SIGNORiP21757

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4481, 4 hits in 842 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MSR1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MSR1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4481
PharosiP21757, Tbio

Protein Ontology

More...PROi		PR:P21757
RNActiP21757, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000038945, Expressed in lung and 171 other tissues
ExpressionAtlasiP21757, baseline and differential
GenevisibleiP21757, HS

Family and domain databases

Gene3Di3.10.250.10, 1 hit
InterProiView protein in InterPro
IPR008160, Collagen
IPR003543, Macro_scav_rcpt
IPR001190, SRCR
IPR017448, SRCR-like_dom
IPR036772, SRCR-like_dom_sf
PANTHERiPTHR19331:SF440, PTHR19331:SF440, 1 hit
PfamiView protein in Pfam
PF01391, Collagen, 1 hit
PF03523, Macscav_rec, 1 hit
PF00530, SRCR, 1 hit
PRINTSiPR01408, MACSCAVRCPTR
PR00258, SPERACTRCPTR
SMARTiView protein in SMART
SM00202, SR, 1 hit
SUPFAMiSSF56487, SSF56487, 1 hit
PROSITEiView protein in PROSITE
PS00420, SRCR_1, 1 hit
PS50287, SRCR_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMSRE_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P21757
Secondary accession number(s): D3DSP3
, O60505, P21759, Q45F10
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1991
Last sequence update: May 1, 1991
Last modified: December 2, 2020
This is version 203 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again