UniProtKB - P21757 (MSRE_HUMAN)
Macrophage scavenger receptor types I and II
MSR1
Functioni
GO - Molecular functioni
- amyloid-beta binding Source: ARUK-UCL
- cargo receptor activity Source: ARUK-UCL
- low-density lipoprotein particle binding Source: BHF-UCL
- scavenger receptor activity Source: ARUK-UCL
GO - Biological processi
- amyloid-beta clearance Source: ARUK-UCL
- cholesterol transport Source: BHF-UCL
- negative regulation of gene expression Source: ARUK-UCL
- phagocytosis, engulfment Source: ARUK-UCL
- plasma lipoprotein particle clearance Source: BHF-UCL
- positive regulation of cholesterol storage Source: BHF-UCL
- positive regulation of macrophage derived foam cell differentiation Source: BHF-UCL
- receptor-mediated endocytosis Source: ARUK-UCL
Keywordsi
Molecular function | Receptor |
Biological process | Endocytosis |
Enzyme and pathway databases
PathwayCommonsi | P21757 |
Reactomei | R-HSA-3000480, Scavenging by Class A Receptors |
SIGNORi | P21757 |
Names & Taxonomyi
Protein namesi | Recommended name: Macrophage scavenger receptor types I and IIAlternative name(s): Macrophage acetylated LDL receptor I and II Scavenger receptor class A member 1 CD_antigen: CD204 |
Gene namesi | Name:MSR1 Synonyms:SCARA1 |
Organismi | Homo sapiens (Human) |
Taxonomic identifieri | 9606 [NCBI] |
Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Proteomesi |
|
Organism-specific databases
EuPathDBi | HostDB:ENSG00000038945.14 |
HGNCi | HGNC:7376, MSR1 |
MIMi | 153622, gene |
neXtProti | NX_P21757 |
Subcellular locationi
Other locations
Extracellular region or secreted
- low-density lipoprotein particle Source: UniProtKB-KW
Plasma Membrane
- external side of plasma membrane Source: GO_Central
- integral component of plasma membrane Source: ProtInc
- plasma membrane Source: ARUK-UCL
Other locations
- collagen trimer Source: UniProtKB-KW
- endocytic vesicle membrane Source: Reactome
- integral component of membrane Source: ARUK-UCL
Topology
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Topological domaini | 1 – 50 | CytoplasmicSequence analysisAdd BLAST | 50 | |
Transmembranei | 51 – 76 | Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST | 26 | |
Topological domaini | 77 – 451 | ExtracellularSequence analysisAdd BLAST | 375 |
Keywords - Cellular componenti
LDL, MembranePathology & Biotechi
Involvement in diseasei
Prostate cancer (PC)1 Publication
Barrett esophagus (BE)1 Publication
Organism-specific databases
DisGeNETi | 4481 |
MalaCardsi | MSR1 |
MIMi | 176807, phenotype 614266, phenotype |
OpenTargetsi | ENSG00000038945 |
Orphaneti | 1331, Familial prostate cancer 1232, NON RARE IN EUROPE: Barrett esophagus |
PharmGKBi | PA31181 |
Miscellaneous databases
Pharosi | P21757, Tbio |
Chemistry databases
ChEMBLi | CHEMBL5811 |
Polymorphism and mutation databases
BioMutai | MSR1 |
DMDMi | 127357 |
PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
ChainiPRO_0000181627 | 1 – 451 | Macrophage scavenger receptor types I and IIAdd BLAST | 451 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Modified residuei | 27 | PhosphoserineBy similarity | 1 | |
Glycosylationi | 82 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
Glycosylationi | 102 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
Glycosylationi | 143 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
Glycosylationi | 184 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
Glycosylationi | 221 | N-linked (GlcNAc...) asparagine1 Publication | 1 | |
Glycosylationi | 249 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
Glycosylationi | 267 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
Disulfide bondi | 375 ↔ 439 | PROSITE-ProRule annotation1 Publication | ||
Disulfide bondi | 388 ↔ 449 | PROSITE-ProRule annotation1 Publication | ||
Disulfide bondi | 419 ↔ 429 | PROSITE-ProRule annotation1 Publication |
Keywords - PTMi
Disulfide bond, Glycoprotein, PhosphoproteinProteomic databases
jPOSTi | P21757 |
MassIVEi | P21757 |
PaxDbi | P21757 |
PeptideAtlasi | P21757 |
PRIDEi | P21757 |
ProteomicsDBi | 53900 [P21757-1] 53901 [P21757-2] 53902 [P21757-3] |
PTM databases
GlyGeni | P21757, 7 sites |
iPTMneti | P21757 |
PhosphoSitePlusi | P21757 |
Expressioni
Tissue specificityi
Gene expression databases
Bgeei | ENSG00000038945, Expressed in lung and 171 other tissues |
ExpressionAtlasi | P21757, baseline and differential |
Genevisiblei | P21757, HS |
Organism-specific databases
HPAi | ENSG00000038945, Group enriched (adipose tissue, lung) |
Interactioni
Subunit structurei
Binary interactionsi
Hide detailsP21757
Protein-protein interaction databases
BioGRIDi | 110587, 12 interactors |
IntActi | P21757, 14 interactors |
MINTi | P21757 |
STRINGi | 9606.ENSP00000262101 |
Chemistry databases
BindingDBi | P21757 |
Miscellaneous databases
RNActi | P21757, protein |
Family & Domainsi
Domains and Repeats
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Domaini | 273 – 341 | Collagen-likeAdd BLAST | 69 | |
Domaini | 350 – 450 | SRCRPROSITE-ProRule annotationAdd BLAST | 101 |
Region
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Regioni | 77 – 109 | SpacerCuratedAdd BLAST | 33 |
Coiled coil
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Coiled coili | 171 – 255 | Sequence analysisAdd BLAST | 85 |
Keywords - Domaini
Coiled coil, Collagen, Signal-anchor, Transmembrane, Transmembrane helixPhylogenomic databases
eggNOGi | ENOG502QUW0, Eukaryota |
GeneTreei | ENSGT00950000183074 |
HOGENOMi | CLU_041152_2_0_1 |
InParanoidi | P21757 |
OrthoDBi | 900867at2759 |
PhylomeDBi | P21757 |
TreeFami | TF330855 |
Family and domain databases
Gene3Di | 3.10.250.10, 1 hit |
InterProi | View protein in InterPro IPR008160, Collagen IPR003543, Macro_scav_rcpt IPR001190, SRCR IPR017448, SRCR-like_dom IPR036772, SRCR-like_dom_sf |
PANTHERi | PTHR19331:SF440, PTHR19331:SF440, 1 hit |
Pfami | View protein in Pfam PF01391, Collagen, 1 hit PF03523, Macscav_rec, 1 hit PF00530, SRCR, 1 hit |
PRINTSi | PR01408, MACSCAVRCPTR PR00258, SPERACTRCPTR |
SMARTi | View protein in SMART SM00202, SR, 1 hit |
SUPFAMi | SSF56487, SSF56487, 1 hit |
PROSITEi | View protein in PROSITE PS00420, SRCR_1, 1 hit PS50287, SRCR_2, 1 hit |
s (3+)i Sequence
Sequence statusi: Complete.
This entry describes 3 produced by isoformsialternative splicing. AlignAdd to basketThis entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All
This isoform has been chosen as the sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. canonicali
10 20 30 40 50
MEQWDHFHNQ QEDTDSCSES VKFDARSMTA LLPPNPKNSP SLQEKLKSFK
60 70 80 90 100
AALIALYLLV FAVLIPLIGI VAAQLLKWET KNCSVSSTNA NDITQSLTGK
110 120 130 140 150
GNDSEEEMRF QEVFMEHMSN MEKRIQHILD MEANLMDTEH FQNFSMTTDQ
160 170 180 190 200
RFNDILLQLS TLFSSVQGHG NAIDEISKSL ISLNTTLLDL QLNIENLNGK
210 220 230 240 250
IQENTFKQQE EISKLEERVY NVSAEIMAMK EEQVHLEQEI KGEVKVLNNI
260 270 280 290 300
TNDLRLKDWE HSQTLRNITL IQGPPGPPGE KGDRGPTGES GPRGFPGPIG
310 320 330 340 350
PPGLKGDRGA IGFPGSRGLP GYAGRPGNSG PKGQKGEKGS GNTLTPFTKV
360 370 380 390 400
RLVGGSGPHE GRVEILHSGQ WGTICDDRWE VRVGQVVCRS LGYPGVQAVH
410 420 430 440 450
KAAHFGQGTG PIWLNEVFCF GRESSIEECK IRQWGTRACS HSEDAGVTCT
L
The sequence of this isoform differs from the canonical sequence as follows:
345-358: TPFTKVRLVGGSGP → RPVQLTDHIRAGPS
359-451: Missing.
The sequence of this isoform differs from the canonical sequence as follows:
345-408: TPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQG → S
Computationally mapped potential isoform sequencesi
There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basketB4DDJ5 | B4DDJ5_HUMAN | Macrophage scavenger receptor types... | MSR1 | 469 | Annotation score: | ||
H0YBY2 | H0YBY2_HUMAN | Macrophage scavenger receptor types... | MSR1 | 149 | Annotation score: | ||
E5RFW8 | E5RFW8_HUMAN | Macrophage scavenger receptor types... | MSR1 | 64 | Annotation score: | ||
E5RI91 | E5RI91_HUMAN | Macrophage scavenger receptor types... | MSR1 | 58 | Annotation score: | ||
E5RFI4 | E5RFI4_HUMAN | Macrophage scavenger receptor types... | MSR1 | 37 | Annotation score: |
Natural variant
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Natural variantiVAR_025190 | 23 | F → C1 PublicationCorresponds to variant dbSNP:rs35175081Ensembl. | 1 | |
Natural variantiVAR_066581 | 36 | P → A Found in a family with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs749666450Ensembl. | 1 | |
Natural variantiVAR_066582 | 41 | S → Y Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs145597376Ensembl. | 1 | |
Natural variantiVAR_066583 | 113 | V → A Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs117359034EnsemblClinVar. | 1 | |
Natural variantiVAR_066584 | 174 | D → Y Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs72552387EnsemblClinVar. | 1 | |
Natural variantiVAR_066585 | 254 | L → V Found in patients with Barrett esophagus. 1 PublicationCorresponds to variant dbSNP:rs387906645EnsemblClinVar. | 1 | |
Natural variantiVAR_052061 | 269 | T → I. Corresponds to variant dbSNP:rs13306543Ensembl. | 1 | |
Natural variantiVAR_025191 | 275 | P → A2 PublicationsCorresponds to variant dbSNP:rs2229388Ensembl. | 1 | |
Natural variantiVAR_066586 | 369 | G → S Found in a family with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs776370129Ensembl. | 1 | |
Natural variantiVAR_066587 | 441 | H → R Found in patients with prostate cancer. 1 PublicationCorresponds to variant dbSNP:rs138749399Ensembl. | 1 |
Alternative sequence
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Alternative sequenceiVSP_036842 | 345 – 408 | TPFTK…HFGQG → S in isoform III. 1 PublicationAdd BLAST | 64 | |
Alternative sequenceiVSP_006229 | 345 – 358 | TPFTK…GGSGP → RPVQLTDHIRAGPS in isoform II. 1 PublicationAdd BLAST | 14 | |
Alternative sequenceiVSP_006230 | 359 – 451 | Missing in isoform II. 1 PublicationAdd BLAST | 93 |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | D90187 mRNA Translation: BAA14208.1 D90188 mRNA Translation: BAA14209.1 AF037351 mRNA Translation: AAC09251.1 DQ144993 Genomic DNA Translation: AAZ38715.1 AC023396 Genomic DNA No translation available. CH471080 Genomic DNA Translation: EAW63832.1 CH471080 Genomic DNA Translation: EAW63830.1 CH471080 Genomic DNA Translation: EAW63833.1 CH471080 Genomic DNA Translation: EAW63834.1 BC063878 mRNA Translation: AAH63878.1 D13263 Genomic DNA No translation available. |
CCDSi | CCDS5995.1 [P21757-1] CCDS5996.1 [P21757-3] CCDS5997.1 [P21757-2] |
PIRi | A38415 B38415 |
RefSeqi | NP_002436.1, NM_002445.3 [P21757-2] NP_619729.1, NM_138715.2 [P21757-1] NP_619730.1, NM_138716.2 [P21757-3] |
Genome annotation databases
Ensembli | ENST00000262101; ENSP00000262101; ENSG00000038945 [P21757-1] ENST00000350896; ENSP00000262100; ENSG00000038945 [P21757-3] ENST00000355282; ENSP00000347430; ENSG00000038945 [P21757-3] ENST00000381998; ENSP00000371428; ENSG00000038945 [P21757-2] |
GeneIDi | 4481 |
KEGGi | hsa:4481 |
UCSCi | uc003wwz.4, human [P21757-1] |
Keywords - Coding sequence diversityi
Alternative splicing, PolymorphismSimilar proteinsi
Cross-referencesi
Web resourcesi
NIEHS-SNPs |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | D90187 mRNA Translation: BAA14208.1 D90188 mRNA Translation: BAA14209.1 AF037351 mRNA Translation: AAC09251.1 DQ144993 Genomic DNA Translation: AAZ38715.1 AC023396 Genomic DNA No translation available. CH471080 Genomic DNA Translation: EAW63832.1 CH471080 Genomic DNA Translation: EAW63830.1 CH471080 Genomic DNA Translation: EAW63833.1 CH471080 Genomic DNA Translation: EAW63834.1 BC063878 mRNA Translation: AAH63878.1 D13263 Genomic DNA No translation available. |
CCDSi | CCDS5995.1 [P21757-1] CCDS5996.1 [P21757-3] CCDS5997.1 [P21757-2] |
PIRi | A38415 B38415 |
RefSeqi | NP_002436.1, NM_002445.3 [P21757-2] NP_619729.1, NM_138715.2 [P21757-1] NP_619730.1, NM_138716.2 [P21757-3] |
3D structure databases
SMRi | P21757 |
ModBasei | Search... |
Protein-protein interaction databases
BioGRIDi | 110587, 12 interactors |
IntActi | P21757, 14 interactors |
MINTi | P21757 |
STRINGi | 9606.ENSP00000262101 |
Chemistry databases
BindingDBi | P21757 |
ChEMBLi | CHEMBL5811 |
PTM databases
GlyGeni | P21757, 7 sites |
iPTMneti | P21757 |
PhosphoSitePlusi | P21757 |
Polymorphism and mutation databases
BioMutai | MSR1 |
DMDMi | 127357 |
Proteomic databases
jPOSTi | P21757 |
MassIVEi | P21757 |
PaxDbi | P21757 |
PeptideAtlasi | P21757 |
PRIDEi | P21757 |
ProteomicsDBi | 53900 [P21757-1] 53901 [P21757-2] 53902 [P21757-3] |
Protocols and materials databases
Antibodypediai | 601, 903 antibodies |
DNASUi | 4481 |
Genome annotation databases
Ensembli | ENST00000262101; ENSP00000262101; ENSG00000038945 [P21757-1] ENST00000350896; ENSP00000262100; ENSG00000038945 [P21757-3] ENST00000355282; ENSP00000347430; ENSG00000038945 [P21757-3] ENST00000381998; ENSP00000371428; ENSG00000038945 [P21757-2] |
GeneIDi | 4481 |
KEGGi | hsa:4481 |
UCSCi | uc003wwz.4, human [P21757-1] |
Organism-specific databases
CTDi | 4481 |
DisGeNETi | 4481 |
EuPathDBi | HostDB:ENSG00000038945.14 |
GeneCardsi | MSR1 |
HGNCi | HGNC:7376, MSR1 |
HPAi | ENSG00000038945, Group enriched (adipose tissue, lung) |
MalaCardsi | MSR1 |
MIMi | 153622, gene 176807, phenotype 614266, phenotype |
neXtProti | NX_P21757 |
OpenTargetsi | ENSG00000038945 |
Orphaneti | 1331, Familial prostate cancer 1232, NON RARE IN EUROPE: Barrett esophagus |
PharmGKBi | PA31181 |
GenAtlasi | Search... |
Phylogenomic databases
eggNOGi | ENOG502QUW0, Eukaryota |
GeneTreei | ENSGT00950000183074 |
HOGENOMi | CLU_041152_2_0_1 |
InParanoidi | P21757 |
OrthoDBi | 900867at2759 |
PhylomeDBi | P21757 |
TreeFami | TF330855 |
Enzyme and pathway databases
PathwayCommonsi | P21757 |
Reactomei | R-HSA-3000480, Scavenging by Class A Receptors |
SIGNORi | P21757 |
Miscellaneous databases
BioGRID-ORCSi | 4481, 4 hits in 842 CRISPR screens |
ChiTaRSi | MSR1, human |
GeneWikii | MSR1 |
GenomeRNAii | 4481 |
Pharosi | P21757, Tbio |
PROi | PR:P21757 |
RNActi | P21757, protein |
SOURCEi | Search... |
Gene expression databases
Bgeei | ENSG00000038945, Expressed in lung and 171 other tissues |
ExpressionAtlasi | P21757, baseline and differential |
Genevisiblei | P21757, HS |
Family and domain databases
Gene3Di | 3.10.250.10, 1 hit |
InterProi | View protein in InterPro IPR008160, Collagen IPR003543, Macro_scav_rcpt IPR001190, SRCR IPR017448, SRCR-like_dom IPR036772, SRCR-like_dom_sf |
PANTHERi | PTHR19331:SF440, PTHR19331:SF440, 1 hit |
Pfami | View protein in Pfam PF01391, Collagen, 1 hit PF03523, Macscav_rec, 1 hit PF00530, SRCR, 1 hit |
PRINTSi | PR01408, MACSCAVRCPTR PR00258, SPERACTRCPTR |
SMARTi | View protein in SMART SM00202, SR, 1 hit |
SUPFAMi | SSF56487, SSF56487, 1 hit |
PROSITEi | View protein in PROSITE PS00420, SRCR_1, 1 hit PS50287, SRCR_2, 1 hit |
ProtoNeti | Search... |
MobiDBi | Search... |
Entry informationi
Entry namei | MSRE_HUMAN | |
Accessioni | P21757Primary (citable) accession number: P21757 Secondary accession number(s): D3DSP3 Q45F10 | |
Entry historyi | Integrated into UniProtKB/Swiss-Prot: | May 1, 1991 |
Last sequence update: | May 1, 1991 | |
Last modified: | December 2, 2020 | |
This is version 203 of the entry and version 1 of the sequence. See complete history. | ||
Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program | |
Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Miscellaneousi
Keywords - Technical termi
Reference proteomeDocuments
- Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - Human chromosome 8
Human chromosome 8: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries