Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 218 (16 Oct 2019)
Sequence version 2 (01 May 1992)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcription initiation factor TFIID subunit 1

Gene

TAF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Largest component and core scaffold of the TFIID basal transcription factor complex (PubMed:25412659, PubMed:27007846). Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity (PubMed:25412659). Essential for progression of the G1 phase of the cell cycle (PubMed:11278496, PubMed:15053879, PubMed:2038334, PubMed:8450888, PubMed:8625415, PubMed:9660973, PubMed:9858607). Exhibits histone acetyltransferase activity towards histones H3 and H4 (PubMed:15870300).10 Publications

Miscellaneous

Isoforms including the downstream (d) exons are preferentially expressed in brain, and may play a role in the regulation of genes involved in dopamine processing and transport.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Autophosphorylates on Ser residues. Inhibited by retinoblastoma tumor suppressor protein, RB1. Binding to TAF1 or CIITA inhibits the histone acetyltransferase activity.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi1195 – 1273HMG boxAdd BLAST79

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, DNA-binding, Kinase, Serine/threonine-protein kinase, Transferase
Biological processCell cycle, Host-virus interaction, Transcription, Transcription regulation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-167161 HIV Transcription Initiation
R-HSA-167162 RNA Polymerase II HIV Promoter Escape
R-HSA-167172 Transcription of the HIV genome
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-73776 RNA Polymerase II Promoter Escape
R-HSA-73779 RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
R-HSA-75953 RNA Polymerase II Transcription Initiation
R-HSA-76042 RNA Polymerase II Transcription Initiation And Promoter Clearance

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P21675

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription initiation factor TFIID subunit 1 (EC:2.3.1.481 Publication, EC:2.7.11.1)
Alternative name(s):
Cell cycle gene 1 protein
TBP-associated factor 250 kDa
Short name:
p250
Transcription initiation factor TFIID 250 kDa subunit
Short name:
TAF(II)250
Short name:
TAFII-250
Short name:
TAFII250
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TAF1
Synonyms:BA2R, CCG1, CCGS, TAF2A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11535 TAF1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
313650 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P21675

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Dystonia 3, torsion, X-linked (DYT3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA X-linked dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT3 is characterized by severe progressive torsion dystonia followed by parkinsonism. It has a well-defined pathology of extensive neuronal loss and mosaic gliosis in the striatum (caudate nucleus and putamen) which appears to resemble that in Huntington disease.
Related information in OMIM
Mental retardation, X-linked, syndromic, 33 (MRXS33)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA mental retardation syndrome characterized by intellectual deficit, delayed psychomotor development, delayed speech and language, and characteristic facial features. Mental retardation is defined by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_076394575P → S in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321630Ensembl.1
Natural variantiVAR_076395786C → R in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321628Ensembl.1
Natural variantiVAR_076396955D → H in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321631Ensembl.1
Natural variantiVAR_0763971225R → W in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321629Ensembl.1
Natural variantiVAR_0763981316I → T in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321627Ensembl.1
Natural variantiVAR_0763991431R → H in MRXS33; unknown pathological significance. 1 Publication1
Natural variantiVAR_0764001496N → H in MRXS33; unknown pathological significance. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi137S → A: No decrease in kinase activity. 1 Publication1
Mutagenesisi145D → A: Reduces kinase activity; when associated with A-147; A-149; A-150; A-152 and A-154. 1 Publication1
Mutagenesisi147D → A: Reduces kinase activity; when associated with A-145; A-149; A-150; A-152 and A-154. 1 Publication1
Mutagenesisi149E → A: Reduces kinase activity; when associated with A-145; A-147; A-150; A-152 and A-154. 1 Publication1
Mutagenesisi150D → A: Reduces kinase activity; when associated with A-145; A-147; A-149; A-152 and A-154. 1 Publication1
Mutagenesisi152D → A: Reduces kinase activity; when associated with A-145; A-147; A-149; A-150 and A-154. 1 Publication1
Mutagenesisi154K → A: Reduces kinase activity; when associated with A-145; A-147; A-149; A-150 and A-152. 1 Publication1
Mutagenesisi305C → A: Reduces kinase activity; when associated with A-307; A-308; A-309 and A-310. 1 Publication1
Mutagenesisi307S → A: Reduces kinase activity; when associated with A-305; A-308; A-309 and A-310. 1 Publication1
Mutagenesisi308D → A: Reduces kinase activity; when associated with A-305; A-307; A-309 and A-310. 1 Publication1
Mutagenesisi309D → A: Reduces kinase activity; when associated with A-305; A-307; A-308 and A-310. 1 Publication1
Mutagenesisi310E → A: Reduces kinase activity; when associated with A-305; A-307; A-308 and A-309. 1 Publication1
Mutagenesisi721E → Q: 25% decrease in histone acetylation. 1 Publication1
Mutagenesisi827 – 829Missing : Dramatic decrease in histone acetylation. 1 Publication3

Keywords - Diseasei

Disease mutation, Dystonia, Mental retardation, Parkinsonism

Organism-specific databases

DisGeNET

More...
DisGeNETi
6872

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
TAF1

MalaCards human disease database

More...
MalaCardsi
TAF1
MIMi300966 phenotype
314250 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000147133

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
53351 X-linked dystonia-parkinsonism
480907 X-linked intellectual disability-global development delay-facial dysmorphism-sacral caudal remnant syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36310

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P21675

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3217390

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2231

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TAF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
115942

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002112151 – 1872Transcription initiation factor TFIID subunit 1Add BLAST1872

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei137Phosphoserine; by autocatalysis1 Publication1
Modified residuei307Phosphoserine; by autocatalysisCombined sources1 Publication1
Modified residuei544N6-acetyllysineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki549Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki562Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1669PhosphoserineBy similarity1
Modified residuei1672PhosphoserineBy similarity1
Modified residuei1778PhosphoserineBy similarity1
Modified residuei1781PhosphoserineBy similarity1
Modified residuei1799PhosphoserineBy similarity1
Modified residuei1826PhosphoserineCombined sources1
Isoform 3 (identifier: P21675-3)
Modified residuei1697PhosphoserineCombined sources1
Isoform 4 (identifier: P21675-4)
Modified residuei1700PhosphoserineCombined sources1
Isoform 2a (identifier: P21675-5)
Modified residuei1700PhosphoserineCombined sources1
Isoform 2g (identifier: P21675-9)
Modified residuei1702PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by casein kinase II in vitro.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P21675

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P21675

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P21675

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P21675

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P21675

PeptideAtlas

More...
PeptideAtlasi
P21675

PRoteomics IDEntifications database

More...
PRIDEi
P21675

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
3401
53886 [P21675-1]
53887 [P21675-2]
53888 [P21675-3]
53889 [P21675-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P21675

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P21675

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000147133 Expressed in 212 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P21675 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P21675 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB016283
HPA001075

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

TAF1 is the largest component of transcription factor TFIID that is composed of TBP and a variety of TBP-associated factors (PubMed:7680771). TAF1, when part of the TFIID complex, interacts with C-terminus of TP53 (PubMed:15053879).

Part of a TFIID-containing RNA polymerase II pre-initiation complex that is composed of TBP and at least GTF2A1, GTF2A2, GTF2E1, GTF2E2, GTF2F1, GTF2H2, GTF2H3, GTF2H4, GTF2H5, GTF2B, TCEA1, ERCC2, ERCC3, TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed:27007846).

Interacts with TAF7; the interaction is direct (PubMed:25412659).

Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. RB1 interacts with the N-terminal domain of TAF1.

Interacts with ASF1A and ASF1B (PubMed:10759893, PubMed:12093919, PubMed:12842904).

Interacts (via bromo domains) with acetylated lysine residues on the N-terminus of histone H1.4, H2A, H2B, H3 and H4 (in vitro) (PubMed:22464331).

10 Publications

(Microbial infection) Interacts with SV40 Large T antigen.

1 Publication

(Microbial infection) Interacts with herpes simplex virus 1 ICP4.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112735, 86 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-915 General transcription factor complex TFIID
CPX-930 General transcription factor complex TFIID, TAF4B variant

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P21675

Database of interacting proteins

More...
DIPi
DIP-147N

Protein interaction database and analysis system

More...
IntActi
P21675, 47 interactors

Molecular INTeraction database

More...
MINTi
P21675

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000406549

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P21675

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11872
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P21675

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P21675

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 414Protein kinase 1Add BLAST414
Domaini1397 – 1467Bromo 1PROSITE-ProRule annotationAdd BLAST71
Domaini1425 – 1872Protein kinase 2Add BLAST448
Domaini1520 – 1590Bromo 2PROSITE-ProRule annotationAdd BLAST71

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni517 – 976Histone acetyltransferase (HAT)Add BLAST460
Regioni1342 – 1629Interaction with ASF1A and ASF1B1 PublicationAdd BLAST288

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1351 – 1358Nuclear localization signalSequence analysis8

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi157 – 165Pro-rich9
Compositional biasi1627 – 1872Asp/Glu-rich (acidic tail)Add BLAST246

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Bromo domain mediates interaction with histones that have acetylated lysine residues at specific positions (PubMed:22464331). The second domain also recognizes and binds histones that are butyrylated and crotonylated (PubMed:26365797).2 Publications

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TAF1 family.Curated

Keywords - Domaini

Bromodomain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0008 Eukaryota
COG5076 LUCA
COG5179 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155242

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000020066

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P21675

KEGG Orthology (KO)

More...
KOi
K03125

Identification of Orthologs from Complete Genome Data

More...
OMAi
KACPLYT

Database of Orthologous Groups

More...
OrthoDBi
103411at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P21675

TreeFam database of animal gene trees

More...
TreeFami
TF313573

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1100.10, 1 hit
1.20.920.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR018359 Bromodomain_CS
IPR040240 TAF1
IPR011177 TAF1_animal
IPR009067 TAF_II_230-bd
IPR036741 TAFII-230_TBP-bd_sf
IPR022591 TFIID_sub1_DUF3591
IPR041670 Znf-CCHC_6

The PANTHER Classification System

More...
PANTHERi
PTHR13900 PTHR13900, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00439 Bromodomain, 2 hits
PF12157 DUF3591, 1 hit
PF09247 TBP-binding, 1 hit
PF15288 zf-CCHC_6, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF003047 TAF1_animal, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00503 BROMODOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00297 BROMO, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47055 SSF47055, 1 hit
SSF47370 SSF47370, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00633 BROMODOMAIN_1, 2 hits
PS50014 BROMODOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 12 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: the TAF1/DYT3 multiple transcript system is composed of 38 evolutionary conserved exons plus 5 downstream exons referred to as exons d1-d5 that are primate-specific. Multiple highly polymorphic variants can be generated by splicing exons d3 and d4 to various combinations of exons 1-37.

This entry has 12 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P21675-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGPGCDLLLR TAATITAAAI MSDTDSDEDS AGGGPFSLAG FLFGNINGAG
60 70 80 90 100
QLEGESVLDD ECKKHLAGLG ALGLGSLITE LTANEELTGT DGALVNDEGW
110 120 130 140 150
VRSTEDAVDY SDINEVAEDE SRRYQQTMGS LQPLCHSDYD EDDYDADCED
160 170 180 190 200
IDCKLMPPPP PPPGPMKKDK DQDSITGEKV DFSSSSDSES EMGPQEATQA
210 220 230 240 250
ESEDGKLTLP LAGIMQHDAT KLLPSVTELF PEFRPGKVLR FLRLFGPGKN
260 270 280 290 300
VPSVWRSARR KRKKKHRELI QEEQIQEVEC SVESEVSQKS LWNYDYAPPP
310 320 330 340 350
PPEQCLSDDE ITMMAPVESK FSQSTGDIDK VTDTKPRVAE WRYGPARLWY
360 370 380 390 400
DMLGVPEDGS GFDYGFKLRK TEHEPVIKSR MIEEFRKLEE NNGTDLLADE
410 420 430 440 450
NFLMVTQLHW EDDIIWDGED VKHKGTKPQR ASLAGWLPSS MTRNAMAYNV
460 470 480 490 500
QQGFAATLDD DKPWYSIFPI DNEDLVYGRW EDNIIWDAQA MPRLLEPPVL
510 520 530 540 550
TLDPNDENLI LEIPDEKEEA TSNSPSKESK KESSLKKSRI LLGKTGVIKE
560 570 580 590 600
EPQQNMSQPE VKDPWNLSND EYYYPKQQGL RGTFGGNIIQ HSIPAVELRQ
610 620 630 640 650
PFFPTHMGPI KLRQFHRPPL KKYSFGALSQ PGPHSVQPLL KHIKKKAKMR
660 670 680 690 700
EQERQASGGG EMFFMRTPQD LTGKDGDLIL AEYSEENGPL MMQVGMATKI
710 720 730 740 750
KNYYKRKPGK DPGAPDCKYG ETVYCHTSPF LGSLHPGQLL QAFENNLFRA
760 770 780 790 800
PIYLHKMPET DFLIIRTRQG YYIRELVDIF VVGQQCPLFE VPGPNSKRAN
810 820 830 840 850
THIRDFLQVF IYRLFWKSKD RPRRIRMEDI KKAFPSHSES SIRKRLKLCA
860 870 880 890 900
DFKRTGMDSN WWVLKSDFRL PTEEEIRAMV SPEQCCAYYS MIAAEQRLKD
910 920 930 940 950
AGYGEKSFFA PEEENEEDFQ MKIDDEVRTA PWNTTRAFIA AMKGKCLLEV
960 970 980 990 1000
TGVADPTGCG EGFSYVKIPN KPTQQKDDKE PQPVKKTVTG TDADLRRLSL
1010 1020 1030 1040 1050
KNAKQLLRKF GVPEEEIKKL SRWEVIDVVR TMSTEQARSG EGPMSKFARG
1060 1070 1080 1090 1100
SRFSVAEHQE RYKEECQRIF DLQNKVLSST EVLSTDTDSS SAEDSDFEEM
1110 1120 1130 1140 1150
GKNIENMLQN KKTSSQLSRE REEQERKELQ RMLLAAGSAA SGNNHRDDDT
1160 1170 1180 1190 1200
ASVTSLNSSA TGRCLKIYRT FRDEEGKEYV RCETVRKPAV IDAYVRIRTT
1210 1220 1230 1240 1250
KDEEFIRKFA LFDEQHREEM RKERRRIQEQ LRRLKRNQEK EKLKGPPEKK
1260 1270 1280 1290 1300
PKKMKERPDL KLKCGACGAI GHMRTNKFCP LYYQTNAPPS NPVAMTEEQE
1310 1320 1330 1340 1350
EELEKTVIHN DNEELIKVEG TKIVLGKQLI ESADEVRRKS LVLKFPKQQL
1360 1370 1380 1390 1400
PPKKKRRVGT TVHCDYLNRP HKSIHRRRTD PMVTLSSILE SIINDMRDLP
1410 1420 1430 1440 1450
NTYPFHTPVN AKVVKDYYKI ITRPMDLQTL RENVRKRLYP SREEFREHLE
1460 1470 1480 1490 1500
LIVKNSATYN GPKHSLTQIS QSMLDLCDEK LKEKEDKLAR LEKAINPLLD
1510 1520 1530 1540 1550
DDDQVAFSFI LDNIVTQKMM AVPDSWPFHH PVNKKFVPDY YKVIVNPMDL
1560 1570 1580 1590 1600
ETIRKNISKH KYQSRESFLD DVNLILANSV KYNGPESQYT KTAQEIVNVC
1610 1620 1630 1640 1650
YQTLTEYDEH LTQLEKDICT AKEAALEEAE LESLDPMTPG PYTPQPPDLY
1660 1670 1680 1690 1700
DTNTSLSMSR DASVFQDESN MSVLDIPSAT PEKQVTQEGE DGDGDLADEE
1710 1720 1730 1740 1750
EGTVQQPQAS VLYEDLLMSE GEDDEEDAGS DEEGDNPFSA IQLSESGSDS
1760 1770 1780 1790 1800
DVGSGGIRPK QPRMLQENTR MDMENEESMM SYEGDGGEAS HGLEDSNISY
1810 1820 1830 1840 1850
GSYEEPDPKS NTQDTSFSSI GGYEVSEEEE DEEEEEQRSG PSVLSQVHLS
1860 1870
EDEEDSEDFH SIAGDSDLDS DE
Length:1,872
Mass (Da):212,677
Last modified:May 1, 1992 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i93BE3D181A72ABEB
GO
Isoform 2 (identifier: P21675-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-177: G → GVSENGEGIILPSIIAPSSLAS

Show »
Length:1,893
Mass (Da):214,714
Checksum:iAE148C222B418BB4
GO
Isoform 3 (identifier: P21675-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1684-1686: Missing.
     1687-1687: Q → QMRQGRGRLGEEDSDVDIEGYDDEEEDGKPKTPAP
     1799-1872: SYGSYEEPDP...AGDSDLDSDE → RYQ

Show »
Length:1,832
Mass (Da):208,364
Checksum:i6C51A0F5885FF667
GO
Isoform 4 (identifier: P21675-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1687-1687: Q → QMRQGRGRLGEEDSDVDIEGYDDEEEDGKPKTPAP

Show »
Length:1,906
Mass (Da):216,451
Checksum:i8880885A3D444515
GO
Isoform 2a (identifier: P21675-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1687-1687: Q → QMRQGRGRLGEEDSDVDIEGYDDEEEDGKPKTPAP
     1799-1872: SYGSYEEPDP...AGDSDLDSDE → RYQ

Show »
Length:1,835
Mass (Da):208,693
Checksum:i4EF338B27B304C13
GO
Isoform 2c (identifier: P21675-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1799-1872: SYGSYEEPDP...AGDSDLDSDE → RYQ

Show »
Length:1,801
Mass (Da):204,919
Checksum:i245D4080FB804D6D
GO
Isoform 2d (identifier: P21675-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1645-1645: Q → QAK
     1799-1872: SYGSYEEPDP...AGDSDLDSDE → RYQ

Show »
Length:1,803
Mass (Da):205,118
Checksum:i1B90B7A234BDB92C
GO
Isoform 2e (identifier: P21675-8) [UniParc]FASTAAdd to basket
Also known as: 2F

The sequence of this isoform differs from the canonical sequence as follows:
     1585-1592: PESQYTKT → YMCTTCRT
     1593-1872: Missing.

Show »
Length:1,592
Mass (Da):182,054
Checksum:i72C8271DD47EE24D
GO
Isoform 2g (identifier: P21675-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1645-1645: Q → QAK
     1687-1687: Q → QMRQGRGRLGEEDSDVDIEGYDDEEEDGKPKTPAP
     1799-1872: SYGSYEEPDP...AGDSDLDSDE → RYQ

Show »
Length:1,837
Mass (Da):208,892
Checksum:i5165FAF620722AD3
GO
Isoform 2h (identifier: P21675-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1525-1528: SWPF → IITK
     1529-1872: Missing.

Show »
Length:1,528
Mass (Da):174,433
Checksum:i75267CFDD8211DD6
GO
Isoform 2i (identifier: P21675-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1525-1540: SWPFHHPVNKKFVPDY → VSCLCAKYFLAISSPS
     1541-1872: Missing.

Show »
Length:1,540
Mass (Da):175,648
Checksum:i4DC37D3B71D7AA10
GO
Isoform N-TAF1 (identifier: P21675-12) [UniParc]FASTAAdd to basket
Also known as: TA14-391

The sequence of this isoform differs from the canonical sequence as follows:
     177-177: G → GVSENGEGIILPSIIAPSSLAS
     1645-1645: Q → QAK

Note: Only detected in brain, highest expression in the caudate nucleus.
Show »
Length:1,895
Mass (Da):214,913
Checksum:i68B48D4582D8A090
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BY98H7BY98_HUMAN
Transcription initiation factor TFI...
TAF1
458Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2K9H7C2K9_HUMAN
Transcription initiation factor TFI...
TAF1
490Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9L7H0Y9L7_HUMAN
Transcription initiation factor TFI...
TAF1
279Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8N6H0Y8N6_HUMAN
Transcription initiation factor TFI...
TAF1
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_020678269L → V2 PublicationsCorresponds to variant dbSNP:rs28382158Ensembl.1
Natural variantiVAR_041930297A → G1 PublicationCorresponds to variant dbSNP:rs35317750Ensembl.1
Natural variantiVAR_041931453G → D in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_077838472N → D Found in a patient with X-linked intellectual disability; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs200177996Ensembl.1
Natural variantiVAR_076394575P → S in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321630Ensembl.1
Natural variantiVAR_041932651E → K in a metastatic melanoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_041933691M → I in a lung bronchoalveolar carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_076395786C → R in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321628Ensembl.1
Natural variantiVAR_076396955D → H in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321631Ensembl.1
Natural variantiVAR_0778391169R → C Found in a patient with X-linked intellectual disability; unknown pathological significance. 1 Publication1
Natural variantiVAR_0763971225R → W in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321629Ensembl.1
Natural variantiVAR_0763981316I → T in MRXS33. 1 PublicationCorresponds to variant dbSNP:rs864321627Ensembl.1
Natural variantiVAR_0484331383V → I. Corresponds to variant dbSNP:rs7050748Ensembl.1
Natural variantiVAR_0763991431R → H in MRXS33; unknown pathological significance. 1 Publication1
Natural variantiVAR_0764001496N → H in MRXS33; unknown pathological significance. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012362177G → GVSENGEGIILPSIIAPSSL AS in isoform 2 and isoform N-TAF1. 1 Publication1
Alternative sequenceiVSP_0533761525 – 1540SWPFH…FVPDY → VSCLCAKYFLAISSPS in isoform 2i. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_0533751525 – 1528SWPF → IITK in isoform 2h. 1 Publication4
Alternative sequenceiVSP_0533771529 – 1872Missing in isoform 2h. 1 PublicationAdd BLAST344
Alternative sequenceiVSP_0533781541 – 1872Missing in isoform 2i. 1 PublicationAdd BLAST332
Alternative sequenceiVSP_0533791585 – 1592PESQYTKT → YMCTTCRT in isoform 2e. 2 Publications8
Alternative sequenceiVSP_0533801593 – 1872Missing in isoform 2e. 2 PublicationsAdd BLAST280
Alternative sequenceiVSP_0533811645Q → QAK in isoform 2d, isoform 2g and isoform N-TAF1. 3 Publications1
Alternative sequenceiVSP_0533821684 – 1686Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_0533831687Q → QMRQGRGRLGEEDSDVDIEG YDDEEEDGKPKTPAP in isoform 2g, isoform 2a, isoform 3 and isoform 4. 3 Publications1
Alternative sequenceiVSP_0533841799 – 1872SYGSY…LDSDE → RYQ in isoform 2g, isoform 2a, isoform 2c, isoform 2d and isoform 3. 2 PublicationsAdd BLAST74

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D90359 mRNA Translation: BAA14374.1
X07024 mRNA Translation: CAA30073.1 Sequence problems.
AB300418 mRNA Translation: BAG15901.1
AY623109 Genomic DNA Translation: AAT38105.1
AL590762 Genomic DNA No translation available.
AL590763 Genomic DNA No translation available.
AB209316 mRNA Translation: BAD92553.1
AJ549247 mRNA Translation: CAD70490.1
AJ549248 mRNA Translation: CAD70491.3
AJ549249 mRNA Translation: CAD70492.2
AJ549250 mRNA Translation: CAD70493.3
AJ555148 mRNA Translation: CAD87527.2
AJ555149 mRNA Translation: CAD87528.2
AM711892 mRNA Translation: CAM98555.1
AM711893 mRNA Translation: CAM98556.1
AM711894 mRNA Translation: CAM98557.1
AM711895 mRNA Translation: CAM98558.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14412.1 [P21675-2]
CCDS35325.1 [P21675-1]
CCDS69783.1 [P21675-12]

Protein sequence database of the Protein Information Resource

More...
PIRi
A40262

NCBI Reference Sequences

More...
RefSeqi
NP_001273003.1, NM_001286074.1 [P21675-12]
NP_004597.2, NM_004606.4 [P21675-2]
NP_620278.1, NM_138923.3 [P21675-1]
XP_005262354.1, XM_005262297.4 [P21675-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000276072; ENSP00000276072; ENSG00000147133 [P21675-2]
ENST00000373790; ENSP00000362895; ENSG00000147133 [P21675-1]
ENST00000423759; ENSP00000406549; ENSG00000147133 [P21675-12]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6872

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6872

UCSC genome browser

More...
UCSCi
uc004dzt.6 human [P21675-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90359 mRNA Translation: BAA14374.1
X07024 mRNA Translation: CAA30073.1 Sequence problems.
AB300418 mRNA Translation: BAG15901.1
AY623109 Genomic DNA Translation: AAT38105.1
AL590762 Genomic DNA No translation available.
AL590763 Genomic DNA No translation available.
AB209316 mRNA Translation: BAD92553.1
AJ549247 mRNA Translation: CAD70490.1
AJ549248 mRNA Translation: CAD70491.3
AJ549249 mRNA Translation: CAD70492.2
AJ549250 mRNA Translation: CAD70493.3
AJ555148 mRNA Translation: CAD87527.2
AJ555149 mRNA Translation: CAD87528.2
AM711892 mRNA Translation: CAM98555.1
AM711893 mRNA Translation: CAM98556.1
AM711894 mRNA Translation: CAM98557.1
AM711895 mRNA Translation: CAM98558.1
CCDSiCCDS14412.1 [P21675-2]
CCDS35325.1 [P21675-1]
CCDS69783.1 [P21675-12]
PIRiA40262
RefSeqiNP_001273003.1, NM_001286074.1 [P21675-12]
NP_004597.2, NM_004606.4 [P21675-2]
NP_620278.1, NM_138923.3 [P21675-1]
XP_005262354.1, XM_005262297.4 [P21675-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1EQFX-ray2.10A1359-1638[»]
3AADX-ray3.30A1342-1629[»]
3UV4X-ray1.89A/B1501-1635[»]
3UV5X-ray2.03A1373-1635[»]
4RGWX-ray2.30A579-1215[»]
4YYMX-ray1.50A/B1497-1638[»]
4YYNX-ray1.85A/B1497-1638[»]
5FURelectron microscopy8.50G1-1872[»]
5I1QX-ray1.50A1497-1638[»]
5I29X-ray1.21A1497-1638[»]
5MG2X-ray1.75A1501-1635[»]
6BQDX-ray2.14A/B1501-1630[»]
6FICX-ray2.18T1359-1638[»]
6MZDelectron microscopy9.80A21-1872[»]
6MZLelectron microscopy23.00A1-1872[»]
6MZMelectron microscopy7.50A588-1083[»]
SMRiP21675
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi112735, 86 interactors
ComplexPortaliCPX-915 General transcription factor complex TFIID
CPX-930 General transcription factor complex TFIID, TAF4B variant
CORUMiP21675
DIPiDIP-147N
IntActiP21675, 47 interactors
MINTiP21675
STRINGi9606.ENSP00000406549

Chemistry databases

BindingDBiP21675
ChEMBLiCHEMBL3217390
GuidetoPHARMACOLOGYi2231

PTM databases

iPTMnetiP21675
PhosphoSitePlusiP21675

Polymorphism and mutation databases

BioMutaiTAF1
DMDMi115942

Proteomic databases

EPDiP21675
jPOSTiP21675
MassIVEiP21675
MaxQBiP21675
PaxDbiP21675
PeptideAtlasiP21675
PRIDEiP21675
ProteomicsDBi3401
53886 [P21675-1]
53887 [P21675-2]
53888 [P21675-3]
53889 [P21675-4]

Genome annotation databases

EnsembliENST00000276072; ENSP00000276072; ENSG00000147133 [P21675-2]
ENST00000373790; ENSP00000362895; ENSG00000147133 [P21675-1]
ENST00000423759; ENSP00000406549; ENSG00000147133 [P21675-12]
GeneIDi6872
KEGGihsa:6872
UCSCiuc004dzt.6 human [P21675-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6872
DisGeNETi6872

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TAF1
GeneReviewsiTAF1
HGNCiHGNC:11535 TAF1
HPAiCAB016283
HPA001075
MalaCardsiTAF1
MIMi300966 phenotype
313650 gene
314250 phenotype
neXtProtiNX_P21675
OpenTargetsiENSG00000147133
Orphaneti53351 X-linked dystonia-parkinsonism
480907 X-linked intellectual disability-global development delay-facial dysmorphism-sacral caudal remnant syndrome
PharmGKBiPA36310

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0008 Eukaryota
COG5076 LUCA
COG5179 LUCA
GeneTreeiENSGT00940000155242
HOGENOMiHOG000020066
InParanoidiP21675
KOiK03125
OMAiKACPLYT
OrthoDBi103411at2759
PhylomeDBiP21675
TreeFamiTF313573

Enzyme and pathway databases

ReactomeiR-HSA-167161 HIV Transcription Initiation
R-HSA-167162 RNA Polymerase II HIV Promoter Escape
R-HSA-167172 Transcription of the HIV genome
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-73776 RNA Polymerase II Promoter Escape
R-HSA-73779 RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
R-HSA-75953 RNA Polymerase II Transcription Initiation
R-HSA-76042 RNA Polymerase II Transcription Initiation And Promoter Clearance
SIGNORiP21675

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TAF1 human
EvolutionaryTraceiP21675

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TAF1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6872
PharosiP21675

Protein Ontology

More...
PROi
PR:P21675

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000147133 Expressed in 212 organ(s), highest expression level in corpus callosum
ExpressionAtlasiP21675 baseline and differential
GenevisibleiP21675 HS

Family and domain databases

Gene3Di1.10.1100.10, 1 hit
1.20.920.10, 2 hits
InterProiView protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR018359 Bromodomain_CS
IPR040240 TAF1
IPR011177 TAF1_animal
IPR009067 TAF_II_230-bd
IPR036741 TAFII-230_TBP-bd_sf
IPR022591 TFIID_sub1_DUF3591
IPR041670 Znf-CCHC_6
PANTHERiPTHR13900 PTHR13900, 2 hits
PfamiView protein in Pfam
PF00439 Bromodomain, 2 hits
PF12157 DUF3591, 1 hit
PF09247 TBP-binding, 1 hit
PF15288 zf-CCHC_6, 1 hit
PIRSFiPIRSF003047 TAF1_animal, 1 hit
PRINTSiPR00503 BROMODOMAIN
SMARTiView protein in SMART
SM00297 BROMO, 2 hits
SUPFAMiSSF47055 SSF47055, 1 hit
SSF47370 SSF47370, 2 hits
PROSITEiView protein in PROSITE
PS00633 BROMODOMAIN_1, 2 hits
PS50014 BROMODOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTAF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P21675
Secondary accession number(s): A5CVC8
, A5CVC9, A5CVD0, A5CVD1, B1Q2X3, Q59FZ3, Q6IUZ1, Q70Q86, Q70Q87, Q70T00, Q70T01, Q70T02, Q70T03
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1991
Last sequence update: May 1, 1992
Last modified: October 16, 2019
This is version 218 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again