Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 185 (07 Apr 2021)
Sequence version 3 (12 Feb 2003)
Previous versions | rss
Add a publicationFeedback
Protein

cAMP-dependent protein kinase catalytic subunit

Gene

kin-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential for larval development (PubMed:22887816).

Controls the rhythmic contraction of enteric muscles probably by regulating G-protein coupled receptor aex-2-mediated calcium influx in GABAergic DVB neurons (PubMed:24086161).

Plays a role in the control of oocyte meiotic maturation by gonadal sheath cells (PubMed:22887816).

2 Publications

Isoforms a and b: May play a role in the regulation of neuromuscular junctions.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Binding of cAMP to kin-2 regulatory subunits induces dissociation of the heterotetramer. The released catalytic subunits are active and able to phosphorylate their substrates.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei110ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei204Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi87 – 95ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, cAMP, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.11.11, 1045

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-163615, PKA activation
R-CEL-164378, PKA activation in glucagon signalling
R-CEL-180024, DARPP-32 events
R-CEL-381676, Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
R-CEL-392517, Rap1 signalling
R-CEL-432040, Vasopressin regulates renal water homeostasis via Aquaporins
R-CEL-442720, CREB1 phosphorylation through the activation of Adenylate Cyclase
R-CEL-5578775, Ion homeostasis
R-CEL-5610787, Hedgehog 'off' state
R-CEL-8963896, HDL assembly
R-CEL-983231, Factors involved in megakaryocyte development and platelet production

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P21137

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cAMP-dependent protein kinase catalytic subunit (EC:2.7.11.111 Publication)
Short name:
PKA C
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:kin-1
ORF Names:ZK909.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome I

Organism-specific databases

WormBase

More...
WormBasei
ZK909.2a ; CE15473 ; WBGene00002189 ; kin-1
ZK909.2b ; CE15475 ; WBGene00002189 ; kin-1
ZK909.2c ; CE31755 ; WBGene00002189 ; kin-1
ZK909.2d ; CE31756 ; WBGene00002189 ; kin-1
ZK909.2e ; CE31757 ; WBGene00002189 ; kin-1
ZK909.2f ; CE31758 ; WBGene00002189 ; kin-1
ZK909.2g ; CE31759 ; WBGene00002189 ; kin-1
ZK909.2h ; CE31760 ; WBGene00002189 ; kin-1
ZK909.2i ; CE31761 ; WBGene00002189 ; kin-1
ZK909.2j ; CE31762 ; WBGene00002189 ; kin-1
ZK909.2k ; CE31763 ; WBGene00002189 ; kin-1
ZK909.2l ; CE31764 ; WBGene00002189 ; kin-1
ZK909.2m ; CE31765 ; WBGene00002189 ; kin-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown of isoforms a and b in neurons shows a temperature-sensitive adult onset paralysis of the distal part of the body resulting in the loss of backward movements and an inability to lay eggs. RNAi-mediated knockdown of isoforms f and k results in no obvious phenotype.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi125H → Q: Loss of interaction with kin-2 resulting in constitutive activation; when associated with R-234 (in isoform a). 1 Publication1
Mutagenesisi234W → R: Loss of interaction with kin-2 resulting in constitutive activation; when associated with Q-125 (in isoform a). 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000860671 – 404cAMP-dependent protein kinase catalytic subunitAdd BLAST404
Isoform h (identifier: P21137-8)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCurated
Isoform j (identifier: P21137-10)
Initiator methionineiRemovedCurated

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei233PhosphothreonineSequence analysis1
Modified residuei376PhosphothreonineSequence analysis1
Isoform h (identifier: P21137-8)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine1 Publication1
Isoform j (identifier: P21137-10)
Lipidationi2N-myristoyl glycine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform h and isoform j are myristoylated.2 Publications

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P21137

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P21137

PeptideAtlas

More...
PeptideAtlasi
P21137

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at low levels in the embryo. Expression increases after hatching and during larval stages and, despite a decrease, remains high in adults (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00002189, Expressed in pharyngeal muscle cell (C elegans) and 4 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P21137, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer composed of two regulatory subunits and two catalytic subunits.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
532725, 17 interactors

Database of interacting proteins

More...
DIPi
DIP-26547N

STRING: functional protein association networks

More...
STRINGi
6239.ZK909.2c

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P21137

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 335Protein kinasePROSITE-ProRule annotationAdd BLAST255

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0616, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163111

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P21137

Identification of Orthologs from Complete Genome Data

More...
OMAi
WWACGIL

Database of Orthologous Groups

More...
OrthoDBi
963519at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P21137

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14209, STKc_PKA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS
IPR044109, STKc_PKA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069, Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (13+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 13 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform e (identifier: P21137-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPTRLDIVGN LQFSSSTDNG DEDQEADVTA CFVLPSPSSF SKLSILDDPV
60 70 80 90 100
EDFKEFLDKA REDFKQRWEN PAQNTACLDD FDRIKTLGTG SFGRVMLVKH
110 120 130 140 150
KQSGNYYAMK ILDKQKVVKL KQVEHTLNEK RILQAIDFPF LVNMTFSFKD
160 170 180 190 200
NSNLYMVLEF ISGGEMFSHL RRIGRFSEPH SRFYAAQIVL AFEYLHSLDL
210 220 230 240 250
IYRDLKPENL LIDSTGYLKI TDFGFAKRVK GRTWTLCGTP EYLAPEIILS
260 270 280 290 300
KGYNKAVDWW ALGVLIYEMA AGYPPFFADQ PIQIYEKIVS GKVKFPSHFS
310 320 330 340 350
NELKDLLKNL LQVDLTKRYG NLKNGVADIK NHKWFGSTDW IAIYQKKITP
360 370 380 390 400
PSFSKGESNG RLFEALYPRV DGPADTRHFV EEVQEPTEFV IAATPQLEEL

FVEF
Length:404
Mass (Da):46,346
Last modified:February 12, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA7AF458E47B58876
GO
Isoform a (identifier: P21137-2) [UniParc]FASTAAdd to basket
Also known as: Major

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGN...SILDDPVEDF → MLKFLKPKSSDEGSSKDNKNSASL
     349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF

Show »
Length:359
Mass (Da):41,376
Checksum:iFC6F619DE13423ED
GO
Isoform b (identifier: P21137-3) [UniParc]FASTAAdd to basket
Also known as: Minor

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGN...SILDDPVEDF → MLKFLKPKSSDEGSSKDNKNSASL

Show »
Length:375
Mass (Da):43,207
Checksum:iF223CB8D23855ED6
GO
Isoform c (identifier: P21137-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MPTRLDIVGN...DFKQRWENPA → MEEEEWRRRL...SDHWSMKWLF
     348-404: ITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF → VSSYPI

Show »
Length:548
Mass (Da):61,664
Checksum:iA6801D3CC2562500
GO
Isoform d (identifier: P21137-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVED → MSSSSNKKVQVKF

Show »
Length:365
Mass (Da):42,212
Checksum:iA77B551D6E272197
GO
Isoform f (identifier: P21137-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGN...SILDDPVEDF → MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETV
     349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF

Show »
Length:370
Mass (Da):42,788
Checksum:i3FEFB33C4D9F77CC
GO
Isoform g (identifier: P21137-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDF → MGSMVFIV
     349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF

Show »
Length:343
Mass (Da):39,647
Checksum:i72E31AE8EB2A7DD4
GO
Isoform h (identifier: P21137-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGN...SILDDPVEDF → MGNAASGGSS...NGRLAAAETI
     349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF

Show »
Length:381
Mass (Da):43,054
Checksum:i132C7749D7DB2D03
GO
Isoform i (identifier: P21137-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDF → MGSMVFIV

Show »
Length:359
Mass (Da):41,478
Checksum:i944813B3CA3EF047
GO
Isoform j (identifier: P21137-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGN...SILDDPVEDF → MGNAASGGSS...NGRLAAAETI

Show »
Length:397
Mass (Da):44,885
Checksum:i8F4257A19C3CC0B6
GO
Isoform k (identifier: P21137-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MPTRLDIVGN...SILDDPVEDF → MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETV

Show »
Length:386
Mass (Da):44,619
Checksum:i87FEAE1CC31AD9FB
GO
Isoform l (identifier: P21137-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF

Show »
Length:388
Mass (Da):44,515
Checksum:i9376F56725E780B5
GO
Isoform m (identifier: P21137-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVED → MSSSSNKKVQVKF
     349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF

Show »
Length:349
Mass (Da):40,381
Checksum:iC486DFDB5F4F033A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2X0T496A0A2X0T496_CAEEL
cAMP-dependent protein kinase
kin-1 CELE_ZK909.2, ZK909.2
579Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti148F → L in AAA51610 (PubMed:2324104).Curated1
Sequence conflicti220I → V in AAA51610 (PubMed:2324104).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0047561 – 72MPTRL…WENPA → MEEEEWRRRLSAAIRREDEG SLEEDEEDEGFILHPLCRTG PLQMTVKASNSTTTLTPSST TTTSPSMPSSPSDSPSDDFS DDTNTSGVFPLTTALSFPVA PLSPRNTTSSITTGLVKKRR SSSSPEDICREKIPHILLKT SSGVVVPLASRGQRAPAITL QNPPPSAAIRTVPPPSFSTF SVRSLPFKTPNCGSKDDTDA ENMEGLDDDYLRQPTTSTSA PVSPIDHRQVRRGGRGVVVE SQVPNFTAEIFWLKTQLSDH WSMKWLF in isoform c. CuratedAdd BLAST72
Alternative sequenceiVSP_0047511 – 53MPTRL…PVEDF → MLKFLKPKSSDEGSSKDNKN SASL in isoform a and isoform b. CuratedAdd BLAST53
Alternative sequenceiVSP_0047521 – 53MPTRL…PVEDF → MLSSSFFRGSMKERKNEALK NHKSKYISGGYLETV in isoform f and isoform k. CuratedAdd BLAST53
Alternative sequenceiVSP_0047541 – 53MPTRL…PVEDF → MGSMVFIV in isoform g and isoform i. CuratedAdd BLAST53
Alternative sequenceiVSP_0047531 – 53MPTRL…PVEDF → MGNAASGGSSGGGGSARRGN GGGNNGSDYNNAMVFSNGRL AAAETI in isoform h and isoform j. CuratedAdd BLAST53
Alternative sequenceiVSP_0047501 – 52MPTRL…DPVED → MSSSSNKKVQVKF in isoform d and isoform m. CuratedAdd BLAST52
Alternative sequenceiVSP_004757348 – 404ITPPS…LFVEF → VSSYPI in isoform c. CuratedAdd BLAST57
Alternative sequenceiVSP_004758349 – 404TPPSF…LFVEF → EAPFLPKCRGPGDASNFDDY EEEPLRISGTEKCAKEFAEF in isoform a, isoform f, isoform g, isoform h, isoform l and isoform m. CuratedAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M37119 M37118 Genomic DNA Translation: AAA51610.1
Z82096 Genomic DNA Translation: CAD45613.1
Z82096 Genomic DNA Translation: CAD45614.1
Z82096 Genomic DNA Translation: CAD45615.1
Z82096, Z81511 Genomic DNA Translation: CAD45616.1
Z82096, Z81511 Genomic DNA Translation: CAD45617.1
Z82096, Z81511 Genomic DNA Translation: CAD45618.1
Z82096, Z81511 Genomic DNA Translation: CAD45619.1
Z82096, Z81511 Genomic DNA Translation: CAD45620.1
Z82096, Z81511 Genomic DNA Translation: CAD45621.1
Z82096, Z81511 Genomic DNA Translation: CAD45622.1
Z82096, Z81511 Genomic DNA Translation: CAD45623.1
Z82096, Z81511 Genomic DNA Translation: CAB05034.1
Z82096, Z81511 Genomic DNA Translation: CAB05035.1
AJ011936 mRNA Translation: CAB41353.1
AJ011937 mRNA Translation: CAB41354.1
AJ011938 mRNA Translation: CAB41355.1
AJ012354 mRNA Translation: CAB41349.1
AJ012355 mRNA Translation: CAB41350.1
AJ012356 mRNA Translation: CAB41351.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A35755, OKKWC1
B35755, OKKWC2
T21211
T21212

NCBI Reference Sequences

More...
RefSeqi
NP_493605.1, NM_061204.3 [P21137-2]
NP_493606.1, NM_061205.3
NP_740954.1, NM_170958.3 [P21137-8]
NP_740955.1, NM_170959.4
NP_740956.1, NM_170960.3 [P21137-7]
NP_740957.1, NM_170961.1
NP_740958.1, NM_170962.3 [P21137-6]
NP_740959.1, NM_170963.1
NP_740960.1, NM_170964.3 [P21137-12]
NP_740961.1, NM_170965.1 [P21137-1]
NP_740962.1, NM_170966.1 [P21137-13]
NP_740963.1, NM_170967.3
NP_740964.1, NM_170968.3

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
ZK909.2a.1; ZK909.2a.1; WBGene00002189 [P21137-2]
ZK909.2b.1; ZK909.2b.1; WBGene00002189 [P21137-3]
ZK909.2c.1; ZK909.2c.1; WBGene00002189 [P21137-4]
ZK909.2c.2; ZK909.2c.2; WBGene00002189 [P21137-4]
ZK909.2d.1; ZK909.2d.1; WBGene00002189 [P21137-5]
ZK909.2e.1; ZK909.2e.1; WBGene00002189 [P21137-1]
ZK909.2f.1; ZK909.2f.1; WBGene00002189 [P21137-6]
ZK909.2g.1; ZK909.2g.1; WBGene00002189 [P21137-7]
ZK909.2h.1; ZK909.2h.1; WBGene00002189 [P21137-8]
ZK909.2i.1; ZK909.2i.1; WBGene00002189 [P21137-9]
ZK909.2j.1; ZK909.2j.1; WBGene00002189 [P21137-10]
ZK909.2k.1; ZK909.2k.1; WBGene00002189 [P21137-11]
ZK909.2l.1; ZK909.2l.1; WBGene00002189 [P21137-12]
ZK909.2m.1; ZK909.2m.1; WBGene00002189 [P21137-13]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3565407

UCSC genome browser

More...
UCSCi
ZK909.2h.1, c. elegans

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M37119 M37118 Genomic DNA Translation: AAA51610.1
Z82096 Genomic DNA Translation: CAD45613.1
Z82096 Genomic DNA Translation: CAD45614.1
Z82096 Genomic DNA Translation: CAD45615.1
Z82096, Z81511 Genomic DNA Translation: CAD45616.1
Z82096, Z81511 Genomic DNA Translation: CAD45617.1
Z82096, Z81511 Genomic DNA Translation: CAD45618.1
Z82096, Z81511 Genomic DNA Translation: CAD45619.1
Z82096, Z81511 Genomic DNA Translation: CAD45620.1
Z82096, Z81511 Genomic DNA Translation: CAD45621.1
Z82096, Z81511 Genomic DNA Translation: CAD45622.1
Z82096, Z81511 Genomic DNA Translation: CAD45623.1
Z82096, Z81511 Genomic DNA Translation: CAB05034.1
Z82096, Z81511 Genomic DNA Translation: CAB05035.1
AJ011936 mRNA Translation: CAB41353.1
AJ011937 mRNA Translation: CAB41354.1
AJ011938 mRNA Translation: CAB41355.1
AJ012354 mRNA Translation: CAB41349.1
AJ012355 mRNA Translation: CAB41350.1
AJ012356 mRNA Translation: CAB41351.1
PIRiA35755, OKKWC1
B35755, OKKWC2
T21211
T21212
RefSeqiNP_493605.1, NM_061204.3 [P21137-2]
NP_493606.1, NM_061205.3
NP_740954.1, NM_170958.3 [P21137-8]
NP_740955.1, NM_170959.4
NP_740956.1, NM_170960.3 [P21137-7]
NP_740957.1, NM_170961.1
NP_740958.1, NM_170962.3 [P21137-6]
NP_740959.1, NM_170963.1
NP_740960.1, NM_170964.3 [P21137-12]
NP_740961.1, NM_170965.1 [P21137-1]
NP_740962.1, NM_170966.1 [P21137-13]
NP_740963.1, NM_170967.3
NP_740964.1, NM_170968.3

3D structure databases

SMRiP21137
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi532725, 17 interactors
DIPiDIP-26547N
STRINGi6239.ZK909.2c

Proteomic databases

EPDiP21137
PaxDbiP21137
PeptideAtlasiP21137

Genome annotation databases

EnsemblMetazoaiZK909.2a.1; ZK909.2a.1; WBGene00002189 [P21137-2]
ZK909.2b.1; ZK909.2b.1; WBGene00002189 [P21137-3]
ZK909.2c.1; ZK909.2c.1; WBGene00002189 [P21137-4]
ZK909.2c.2; ZK909.2c.2; WBGene00002189 [P21137-4]
ZK909.2d.1; ZK909.2d.1; WBGene00002189 [P21137-5]
ZK909.2e.1; ZK909.2e.1; WBGene00002189 [P21137-1]
ZK909.2f.1; ZK909.2f.1; WBGene00002189 [P21137-6]
ZK909.2g.1; ZK909.2g.1; WBGene00002189 [P21137-7]
ZK909.2h.1; ZK909.2h.1; WBGene00002189 [P21137-8]
ZK909.2i.1; ZK909.2i.1; WBGene00002189 [P21137-9]
ZK909.2j.1; ZK909.2j.1; WBGene00002189 [P21137-10]
ZK909.2k.1; ZK909.2k.1; WBGene00002189 [P21137-11]
ZK909.2l.1; ZK909.2l.1; WBGene00002189 [P21137-12]
ZK909.2m.1; ZK909.2m.1; WBGene00002189 [P21137-13]
GeneIDi3565407
UCSCiZK909.2h.1, c. elegans

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3565407
WormBaseiZK909.2a ; CE15473 ; WBGene00002189 ; kin-1
ZK909.2b ; CE15475 ; WBGene00002189 ; kin-1
ZK909.2c ; CE31755 ; WBGene00002189 ; kin-1
ZK909.2d ; CE31756 ; WBGene00002189 ; kin-1
ZK909.2e ; CE31757 ; WBGene00002189 ; kin-1
ZK909.2f ; CE31758 ; WBGene00002189 ; kin-1
ZK909.2g ; CE31759 ; WBGene00002189 ; kin-1
ZK909.2h ; CE31760 ; WBGene00002189 ; kin-1
ZK909.2i ; CE31761 ; WBGene00002189 ; kin-1
ZK909.2j ; CE31762 ; WBGene00002189 ; kin-1
ZK909.2k ; CE31763 ; WBGene00002189 ; kin-1
ZK909.2l ; CE31764 ; WBGene00002189 ; kin-1
ZK909.2m ; CE31765 ; WBGene00002189 ; kin-1

Phylogenomic databases

eggNOGiKOG0616, Eukaryota
GeneTreeiENSGT00940000163111
InParanoidiP21137
OMAiWWACGIL
OrthoDBi963519at2759
PhylomeDBiP21137

Enzyme and pathway databases

BRENDAi2.7.11.11, 1045
ReactomeiR-CEL-163615, PKA activation
R-CEL-164378, PKA activation in glucagon signalling
R-CEL-180024, DARPP-32 events
R-CEL-381676, Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
R-CEL-392517, Rap1 signalling
R-CEL-432040, Vasopressin regulates renal water homeostasis via Aquaporins
R-CEL-442720, CREB1 phosphorylation through the activation of Adenylate Cyclase
R-CEL-5578775, Ion homeostasis
R-CEL-5610787, Hedgehog 'off' state
R-CEL-8963896, HDL assembly
R-CEL-983231, Factors involved in megakaryocyte development and platelet production
SignaLinkiP21137

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P21137

Gene expression databases

BgeeiWBGene00002189, Expressed in pharyngeal muscle cell (C elegans) and 4 other tissues
ExpressionAtlasiP21137, baseline and differential

Family and domain databases

CDDicd14209, STKc_PKA, 1 hit
InterProiView protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS
IPR044109, STKc_PKA
PfamiView protein in Pfam
PF00069, Pkinase, 1 hit
SMARTiView protein in SMART
SM00220, S_TKc, 1 hit
SUPFAMiSSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKAPC1_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P21137
Secondary accession number(s): O18310
, O18311, Q9UB39, Q9XZP8, Q9XZP9, Q9XZQ0, Q9XZQ8, Q9XZQ9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1991
Last sequence update: February 12, 2003
Last modified: April 7, 2021
This is version 185 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again