Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (16 Oct 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Poly(U)-specific endoribonuclease

Gene

ENDOU

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2'-3'-cyclic phosphate termini.1 Publication

Caution

Was originally (PubMed:2350438) thought to be a serine protease. However, PubMed:18936097 showed it is not the case.1 Publication

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionEndonuclease, Hydrolase, Nuclease, RNA-binding
LigandManganese, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Poly(U)-specific endoribonuclease (EC:3.1.-.-1 Publication)
Alternative name(s):
Placental protein 11
Short name:
PP11
Protein endoU
Uridylate-specific endoribonuclease
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ENDOU
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14369 ENDOU

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606720 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P21128

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi284E → Q: Abolishes endoribonuclease activity and increases RNA-binding activity. 1 Publication1
Mutagenesisi285H → A: Abolishes endoribonuclease activity without affecting RNA-binding activity. 1 Publication1
Mutagenesisi290E → Q: Abolishes endoribonuclease activity without affecting RNA-binding activity. 1 Publication1
Mutagenesisi300H → A: Abolishes endoribonuclease activity without affecting RNA-binding activity. 1 Publication1
Mutagenesisi343K → A: Strongly impairs endoribonuclease activity without affecting RNA-binding activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
8909

Open Targets

More...
OpenTargetsi
ENSG00000111405

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165512645

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P21128

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ENDOU

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296434493

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 181 PublicationAdd BLAST18
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003640519 – 410Poly(U)-specific endoribonucleaseAdd BLAST392

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi24 ↔ 40AlternatePROSITE-ProRule annotation
Disulfide bondi24 ↔ 28AlternatePROSITE-ProRule annotation
Disulfide bondi28 ↔ 58AlternatePROSITE-ProRule annotation
Disulfide bondi38 ↔ 51AlternatePROSITE-ProRule annotation
Disulfide bondi38 ↔ 40AlternatePROSITE-ProRule annotation
Disulfide bondi44 ↔ 50PROSITE-ProRule annotation
Disulfide bondi51 ↔ 58AlternatePROSITE-ProRule annotation
Disulfide bondi90 ↔ 106AlternatePROSITE-ProRule annotation
Disulfide bondi90 ↔ 94AlternatePROSITE-ProRule annotation
Disulfide bondi94 ↔ 124AlternatePROSITE-ProRule annotation
Disulfide bondi104 ↔ 117AlternatePROSITE-ProRule annotation
Disulfide bondi104 ↔ 106AlternatePROSITE-ProRule annotation
Disulfide bondi110 ↔ 116PROSITE-ProRule annotation
Disulfide bondi117 ↔ 124AlternatePROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.

Keywords - PTMi

Disulfide bond

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P21128

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P21128

PeptideAtlas

More...
PeptideAtlasi
P21128

PRoteomics IDEntifications database

More...
PRIDEi
P21128

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
53846 [P21128-1]
53847 [P21128-2]
53848 [P21128-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P21128-2 [P21128-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P21128

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P21128

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Placental-specific, but also associated with various malignant neoplasms.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111405 Expressed in 109 organ(s), highest expression level in vagina

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P21128 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA012388
HPA067448

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114423, 3 interactors

Protein interaction database and analysis system

More...
IntActi
P21128, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000397679

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P21128

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 62SMB 1PROSITE-ProRule annotationAdd BLAST43
Domaini86 – 130SMB 2PROSITE-ProRule annotationAdd BLAST45

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ENDOU family.Curated

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2849 Eukaryota
ENOG410XX8E LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063825

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000247015

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P21128

KEGG Orthology (KO)

More...
KOi
K14648

Identification of Orthologs from Complete Genome Data

More...
OMAi
YGFLHHQ

Database of Orthologous Groups

More...
OrthoDBi
823332at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P21128

TreeFam database of animal gene trees

More...
TreeFami
TF319848

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039787 ENDOU
IPR037227 EndoU-like
IPR018998 EndoU_C
IPR036024 Somatomedin_B-like_dom_sf
IPR020436 Somatomedin_B_chordata
IPR001212 Somatomedin_B_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12439 PTHR12439, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01033 Somatomedin_B, 2 hits
PF09412 XendoU, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00022 SOMATOMEDINB

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00201 SO, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF142877 SSF142877, 1 hit
SSF90188 SSF90188, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00524 SMB_1, 2 hits
PS50958 SMB_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P21128-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRACISLVLA VLCGLAWAGK IESCASRCNE KFNRDAACQC DRRCLWHGNC
60 70 80 90 100
CEDYEHLCTE DHKESEPLPQ LEEETEEALA SNLYSAPTSC QGRCYEAFDK
110 120 130 140 150
HHQCHCNARC QEFGNCCKDF ESLCSDHEVS HSSDAITKEE IQSISEKIYR
160 170 180 190 200
ADTNKAQKED IVLNSQNCIS PSETRNQVDR CPKPLFTYVN EKLFSKPTYA
210 220 230 240 250
AFINLLNNYQ RATGHGEHFS AQELAEQDAF LREIMKTAVM KELYSFLHHQ
260 270 280 290 300
NRYGSEQEFV DDLKNMWFGL YSRGNEEGDS SGFEHVFSGE VKKGKVTGFH
310 320 330 340 350
NWIRFYLEEK EGLVDYYSHI YDGPWDSYPD VLAMQFNWDG YYKEVGSAFI
360 370 380 390 400
GSSPEFEFAL YSLCFIARPG KVCQLSLGGY PLAVRTYTWD KSTYGNGKKY
410
IATAYIVSST
Length:410
Mass (Da):46,872
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCC19484F40355129
GO
Isoform 2 (identifier: P21128-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-59: Missing.

Show »
Length:369
Mass (Da):42,121
Checksum:iF5935AE12D7E924C
GO
Isoform 3 (identifier: P21128-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-82: GKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASN → D

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):39,629
Checksum:iD7F5B74604503201
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti123L → P in BAG37240 (PubMed:14702039).Curated1
Sequence conflicti387Y → H in BAG37240 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03921519 – 82GKIES…ALASN → D in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_03921619 – 59Missing in isoform 2. 3 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M32402 mRNA Translation: AAA36464.1
M36109 mRNA Translation: AAA36465.1
AK075446 mRNA Translation: BAG52139.1
AK300169 mRNA Translation: BAH13227.1
AK314688 mRNA Translation: BAG37240.1
AC004241 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57940.1
BC069715 mRNA Translation: AAH69715.1
BC074763 mRNA Translation: AAH74763.1
BC111782 mRNA Translation: AAI11783.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53784.1 [P21128-3]
CCDS53785.1 [P21128-1]
CCDS8754.1 [P21128-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A34614

NCBI Reference Sequences

More...
RefSeqi
NP_001165910.1, NM_001172439.1 [P21128-1]
NP_001165911.1, NM_001172440.1 [P21128-3]
NP_006016.1, NM_006025.3 [P21128-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000229003; ENSP00000229003; ENSG00000111405 [P21128-2]
ENST00000422538; ENSP00000397679; ENSG00000111405 [P21128-1]
ENST00000545824; ENSP00000445004; ENSG00000111405 [P21128-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8909

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8909

UCSC genome browser

More...
UCSCi
uc001rpt.3 human [P21128-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M32402 mRNA Translation: AAA36464.1
M36109 mRNA Translation: AAA36465.1
AK075446 mRNA Translation: BAG52139.1
AK300169 mRNA Translation: BAH13227.1
AK314688 mRNA Translation: BAG37240.1
AC004241 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57940.1
BC069715 mRNA Translation: AAH69715.1
BC074763 mRNA Translation: AAH74763.1
BC111782 mRNA Translation: AAI11783.1
CCDSiCCDS53784.1 [P21128-3]
CCDS53785.1 [P21128-1]
CCDS8754.1 [P21128-2]
PIRiA34614
RefSeqiNP_001165910.1, NM_001172439.1 [P21128-1]
NP_001165911.1, NM_001172440.1 [P21128-3]
NP_006016.1, NM_006025.3 [P21128-2]

3D structure databases

SMRiP21128
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114423, 3 interactors
IntActiP21128, 2 interactors
STRINGi9606.ENSP00000397679

PTM databases

iPTMnetiP21128
PhosphoSitePlusiP21128

Polymorphism and mutation databases

BioMutaiENDOU
DMDMi296434493

Proteomic databases

MassIVEiP21128
PaxDbiP21128
PeptideAtlasiP21128
PRIDEiP21128
ProteomicsDBi53846 [P21128-1]
53847 [P21128-2]
53848 [P21128-3]
TopDownProteomicsiP21128-2 [P21128-2]

Genome annotation databases

EnsembliENST00000229003; ENSP00000229003; ENSG00000111405 [P21128-2]
ENST00000422538; ENSP00000397679; ENSG00000111405 [P21128-1]
ENST00000545824; ENSP00000445004; ENSG00000111405 [P21128-3]
GeneIDi8909
KEGGihsa:8909
UCSCiuc001rpt.3 human [P21128-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8909
DisGeNETi8909

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ENDOU
HGNCiHGNC:14369 ENDOU
HPAiHPA012388
HPA067448
MIMi606720 gene
neXtProtiNX_P21128
OpenTargetsiENSG00000111405
PharmGKBiPA165512645

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2849 Eukaryota
ENOG410XX8E LUCA
GeneTreeiENSGT00530000063825
HOGENOMiHOG000247015
InParanoidiP21128
KOiK14648
OMAiYGFLHHQ
OrthoDBi823332at2759
PhylomeDBiP21128
TreeFamiTF319848

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8909
PharosiP21128

Protein Ontology

More...
PROi
PR:P21128

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111405 Expressed in 109 organ(s), highest expression level in vagina
GenevisibleiP21128 HS

Family and domain databases

InterProiView protein in InterPro
IPR039787 ENDOU
IPR037227 EndoU-like
IPR018998 EndoU_C
IPR036024 Somatomedin_B-like_dom_sf
IPR020436 Somatomedin_B_chordata
IPR001212 Somatomedin_B_dom
PANTHERiPTHR12439 PTHR12439, 1 hit
PfamiView protein in Pfam
PF01033 Somatomedin_B, 2 hits
PF09412 XendoU, 1 hit
PRINTSiPR00022 SOMATOMEDINB
SMARTiView protein in SMART
SM00201 SO, 2 hits
SUPFAMiSSF142877 SSF142877, 1 hit
SSF90188 SSF90188, 2 hits
PROSITEiView protein in PROSITE
PS00524 SMB_1, 2 hits
PS50958 SMB_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiENDOU_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P21128
Secondary accession number(s): B2RBJ3
, B3KQS7, B7Z6E1, Q2NKJ4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: May 18, 2010
Last modified: October 16, 2019
This is version 162 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again