Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome P450 3A5

Gene

CYP3A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Miscellaneous

Chimeric transcripts, characterized by CYP3A43 exon 1 joined at canonical splice sites to distinct sets of CYP3A5 exons, have been detected. All are possibly produced by trans-splicing. The chimeric transcripts exist in 2 different combinations: CYP3A43 exon 1 joined in frame to CYP3A5 exon 11-13 and CYP3A43 exon 1 joined in frame to CYP3A5 exon 12-13. All chimeric transcripts are expressed at very low levels in the liver (PubMed:11726664).1 Publication

Catalytic activityi

RH + [reduced NADPH--hemoprotein reductase] + O2 = ROH + [oxidized NADPH--hemoprotein reductase] + H2O.

Cofactori

hemeBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi441Iron (heme axial ligand)1

GO - Molecular functioni

  • aromatase activity Source: UniProtKB-EC
  • estrogen 16-alpha-hydroxylase activity Source: BHF-UCL
  • heme binding Source: InterPro
  • iron ion binding Source: InterPro
  • monooxygenase activity Source: UniProtKB
  • oxidoreductase activity Source: BHF-UCL
  • oxygen binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BRENDAi1.14.14.1 2681
ReactomeiR-HSA-211981 Xenobiotics
R-HSA-5423646 Aflatoxin activation and detoxification
SABIO-RKiP20815

Chemistry databases

SwissLipidsiSLP:000001325

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 3A5 (EC:1.14.14.1)
Alternative name(s):
CYPIIIA5
Cytochrome P450 HLp2
Cytochrome P450-PCN3
Gene namesi
Name:CYP3A5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000106258.13
HGNCiHGNC:2638 CYP3A5
MIMi605325 gene
neXtProtiNX_P20815

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

DisGeNETi1577
MalaCardsiCYP3A5
OpenTargetsiENSG00000106258
Orphaneti241043 Tacrolimus dose selection
PharmGKBiPA131

Chemistry databases

ChEMBLiCHEMBL3019
DrugBankiDB00802 Alfentanil
DB00404 Alprazolam
DB06403 Ambrisentan
DB01118 Amiodarone
DB00321 Amitriptyline
DB00381 Amlodipine
DB00701 Amprenavir
DB06605 Apixaban
DB00673 Aprepitant
DB00278 Argatroban
DB01238 Aripiprazole
DB06413 Armodafinil
DB06697 Artemether
DB00637 Astemizole
DB01076 Atorvastatin
DB06626 Axitinib
DB00972 Azelastine
DB04957 Azimilide
DB00394 Beclomethasone dipropionate
DB08873 Boceprevir
DB08870 Brentuximab vedotin
DB00921 Buprenorphine
DB00490 Buspirone
DB06772 Cabazitaxel
DB00201 Caffeine
DB00564 Carbamazepine
DB00439 Cerivastatin
DB06419 Cethromycin
DB00446 Chloramphenicol
DB00608 Chloroquine
DB01114 Chlorphenamine
DB01166 Cilostazol
DB00501 Cimetidine
DB00537 Ciprofloxacin
DB00604 Cisapride
DB01211 Clarithromycin
DB00575 Clonidine
DB00758 Clopidogrel
DB05239 Cobimetinib
DB00907 Cocaine
DB00318 Codeine
DB08865 Crizotinib
DB00531 Cyclophosphamide
DB00091 Cyclosporine
DB09102 Daclatasvir
DB00250 Dapsone
DB01254 Dasatinib
DB00694 Daunorubicin
DB00705 Delavirdine
DB01234 Dexamethasone
DB04856 Dexloxiglumide
DB00514 Dextromethorphan
DB00829 Diazepam
DB00343 Diltiazem
DB00822 Disulfiram
DB01248 Docetaxel
DB08930 Dolutegravir
DB01184 Domperidone
DB01126 Dutasteride
DB08899 Enzalutamide
DB00700 Eplerenone
DB00530 Erlotinib
DB00783 Estradiol
DB00655 Estrone
DB00593 Ethosuximide
DB00773 Etoposide
DB01023 Felodipine
DB00813 Fentanyl
DB01216 Finasteride
DB00196 Fluconazole
DB00472 Fluoxetine
DB00499 Flutamide
DB00588 Fluticasone Propionate
DB01095 Fluvastatin
DB00176 Fluvoxamine
DB00317 Gefitinib
DB06730 Gestodene
DB00889 Granisetron
DB01218 Halofantrine
DB00502 Haloperidol
DB00741 Hydrocortisone
DB06789 Hydroxyprogesterone caproate
DB09053 Ibrutinib
DB01181 Ifosfamide
DB04946 Iloperidone
DB00619 Imatinib
DB00224 Indinavir
DB00762 Irinotecan
DB01167 Itraconazole
DB01026 Ketoconazole
DB01259 Lapatinib
DB00528 Lercanidipine
DB01227 Levomethadyl Acetate
DB00281 Lidocaine
DB00678 Losartan
DB00227 Lovastatin
DB00333 Methadone
DB01388 Mibefradil
DB00683 Midazolam
DB00834 Mifepristone
DB00745 Modafinil
DB00688 Mycophenolate mofetil
DB00731 Nateglinide
DB01149 Nefazodone
DB00220 Nelfinavir
DB00238 Nevirapine
DB00622 Nicardipine
DB01115 Nifedipine
DB00393 Nimodipine
DB00401 Nisoldipine
DB01054 Nitrendipine
DB00717 Norethisterone
DB01059 Norfloxacin
DB00540 Nortriptyline
DB00904 Ondansetron
DB00842 Oxazepam
DB00776 Oxcarbazepine
DB01062 Oxybutynin
DB00497 Oxycodone
DB01229 Paclitaxel
DB01267 Paliperidone
DB09297 Paritaprevir
DB00738 Pentamidine
DB08883 Perampanel
DB00780 Phenelzine
DB01174 Phenobarbital
DB00252 Phenytoin
DB01100 Pimozide
DB08901 Ponatinib
DB00175 Pravastatin
DB01058 Praziquantel
DB00396 Progesterone
DB00571 Propranolol
DB01224 Quetiapine
DB01103 Quinacrine
DB00468 Quinine
DB00863 Ranitidine
DB00206 Reserpine
DB01045 Rifampicin
DB01201 Rifapentine
DB00734 Risperidone
DB00503 Ritonavir
DB06228 Rivaroxaban
DB06176 Romidepsin
DB01098 Rosuvastatin
DB00938 Salmeterol
DB01232 Saquinavir
DB06335 Saxagliptin
DB06731 Seproxetine
DB00203 Sildenafil
DB00641 Simvastatin
DB00877 Sirolimus
DB00398 Sorafenib
DB00795 Sulfasalazine
DB01268 Sunitinib
DB00864 Tacrolimus
DB00675 Tamoxifen
DB00976 Telithromycin
DB06287 Temsirolimus
DB00444 Teniposide
DB00342 Terfenadine
DB00624 Testosterone
DB01041 Thalidomide
DB05773 Trastuzumab emtansine
DB00656 Trazodone
DB00755 Tretinoin
DB00897 Triazolam
DB00197 Troglitazone
DB01361 Troleandomycin
DB06267 Udenafil
DB00313 Valproic Acid
DB00862 Vardenafil
DB00661 Verapamil
DB00541 Vincristine
DB00582 Voriconazole
DB09068 Vortioxetine
DB00943 Zalcitabine
DB00962 Zaleplon
DB00246 Ziprasidone
DB00425 Zolpidem
GuidetoPHARMACOLOGYi1338

Polymorphism and mutation databases

BioMutaiCYP3A5
DMDMi117157

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000517871 – 502Cytochrome P450 3A5Add BLAST502

Proteomic databases

PaxDbiP20815
PeptideAtlasiP20815
PRIDEiP20815
ProteomicsDBi53804
53805 [P20815-2]

PTM databases

iPTMnetiP20815
PhosphoSitePlusiP20815

Expressioni

Inductioni

P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

Gene expression databases

BgeeiENSG00000106258 Expressed in 182 organ(s), highest expression level in liver
CleanExiHS_CYP3A5
ExpressionAtlasiP20815 baseline and differential
GenevisibleiP20815 HS

Organism-specific databases

HPAiHPA072245

Interactioni

Protein-protein interaction databases

BioGridi107949, 7 interactors
IntActiP20815, 4 interactors
STRINGi9606.ENSP00000222982

Chemistry databases

BindingDBiP20815

Structurei

Secondary structure

1502
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP20815
SMRiP20815
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGiKOG0158 Eukaryota
COG2124 LUCA
GeneTreeiENSGT00900000140779
HOGENOMiHOG000082412
HOVERGENiHBG108567
InParanoidiP20815
KOiK17690
OMAiPAIAKHI
OrthoDBiEOG091G0JNC
PhylomeDBiP20815
TreeFamiTF105087

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128 Cyt_P450
IPR017972 Cyt_P450_CS
IPR008072 Cyt_P450_E_CYP3A
IPR002402 Cyt_P450_E_grp-II
IPR036396 Cyt_P450_sf
PfamiView protein in Pfam
PF00067 p450, 1 hit
PRINTSiPR00464 EP450II
PR01689 EP450IICYP3A
PR00385 P450
SUPFAMiSSF48264 SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086 CYTOCHROME_P450, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: P20815-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLIPNLAVE TWLLLAVSLV LLYLYGTRTH GLFKRLGIPG PTPLPLLGNV
60 70 80 90 100
LSYRQGLWKF DTECYKKYGK MWGTYEGQLP VLAITDPDVI RTVLVKECYS
110 120 130 140 150
VFTNRRSLGP VGFMKSAISL AEDEEWKRIR SLLSPTFTSG KLKEMFPIIA
160 170 180 190 200
QYGDVLVRNL RREAEKGKPV TLKDIFGAYS MDVITGTSFG VNIDSLNNPQ
210 220 230 240 250
DPFVESTKKF LKFGFLDPLF LSIILFPFLT PVFEALNVSL FPKDTINFLS
260 270 280 290 300
KSVNRMKKSR LNDKQKHRLD FLQLMIDSQN SKETESHKAL SDLELAAQSI
310 320 330 340 350
IFIFAGYETT SSVLSFTLYE LATHPDVQQK LQKEIDAVLP NKAPPTYDAV
360 370 380 390 400
VQMEYLDMVV NETLRLFPVA IRLERTCKKD VEINGVFIPK GSMVVIPTYA
410 420 430 440 450
LHHDPKYWTE PEEFRPERFS KKKDSIDPYI YTPFGTGPRN CIGMRFALMN
460 470 480 490 500
MKLALIRVLQ NFSFKPCKET QIPLKLDTQG LLQPEKPIVL KVDSRDGTLS

GE
Length:502
Mass (Da):57,109
Last modified:February 1, 1991 - v1
Checksum:iD5A2302E2633E717
GO
Isoform 2 (identifier: P20815-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-140: SLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSG → ICATTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL
     141-502: Missing.

Note: No experimental confirmation available.
Show »
Length:140
Mass (Da):15,846
Checksum:iF40CE9C9DAE2CAC3
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q7Z3N0Q7Z3N0_HUMAN
Cytochrome P450 3A5
CYP3A5 DKFZp686I18188
39Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti305A → P no nucleotide entry (PubMed:2802615).Curated1
Sequence conflicti318L → F no nucleotide entry (PubMed:2802615).Curated1
Sequence conflicti324H → D no nucleotide entry (PubMed:2802615).Curated1
Sequence conflicti377C → G no nucleotide entry (PubMed:2802615).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02473128R → C in allele CYP3A5*8. 1 PublicationCorresponds to variant dbSNP:rs55817950Ensembl.1
Natural variantiVAR_02472830H → Y1 PublicationCorresponds to variant dbSNP:rs28383468Ensembl.1
Natural variantiVAR_024732200Q → R in allele CYP3A5*4. 1 PublicationCorresponds to variant dbSNP:rs56411402Ensembl.1
Natural variantiVAR_024729277D → E1 PublicationCorresponds to variant dbSNP:rs28383477Ensembl.1
Natural variantiVAR_024730337A → T in allele CYP3A5*9. 2 PublicationsCorresponds to variant dbSNP:rs28383479Ensembl.1
Natural variantiVAR_029161371I → V. Corresponds to variant dbSNP:rs28365092Ensembl.1
Natural variantiVAR_008365398T → N in allele CYP3A5*2. 2 PublicationsCorresponds to variant dbSNP:rs28365083Ensembl.1
Natural variantiVAR_024733446F → S1 PublicationCorresponds to variant dbSNP:rs41279854Ensembl.1
Natural variantiVAR_029162488I → T. Corresponds to variant dbSNP:rs28365085Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042734107 – 140SLGPV…TFTSG → ICATTSTIKMQTHSVTMWLP PAVLQSQHGVCLFL in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_042735141 – 502Missing in isoform 2. 1 PublicationAdd BLAST362

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04813 mRNA Translation: AAA02993.1
AK299002 mRNA Translation: BAH12923.1
AC005020 Genomic DNA Translation: AAS02016.1
CH236956 Genomic DNA Translation: EAL23868.1
CH471091 Genomic DNA Translation: EAW76638.1
CH471091 Genomic DNA Translation: EAW76642.1
BC033862 mRNA Translation: AAH33862.1
AF280107 Genomic DNA Translation: AAG32288.1
L35912 Genomic DNA Translation: AAB00083.1
S74699 Genomic DNA Translation: AAD14157.1
S74700 Genomic DNA Translation: AAD14158.1
CCDSiCCDS55134.1 [P20815-2]
CCDS5672.1 [P20815-1]
PIRiA34101
A60558
RefSeqiNP_000768.1, NM_000777.4 [P20815-1]
NP_001177413.1, NM_001190484.2 [P20815-2]
UniGeneiHs.571258

Genome annotation databases

EnsembliENST00000222982; ENSP00000222982; ENSG00000106258 [P20815-1]
ENST00000439761; ENSP00000401269; ENSG00000106258 [P20815-2]
ENST00000646887; ENSP00000496704; ENSG00000106258 [P20815-2]
GeneIDi1577
KEGGihsa:1577
UCSCiuc003urq.4 human [P20815-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP3A5 alleles

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04813 mRNA Translation: AAA02993.1
AK299002 mRNA Translation: BAH12923.1
AC005020 Genomic DNA Translation: AAS02016.1
CH236956 Genomic DNA Translation: EAL23868.1
CH471091 Genomic DNA Translation: EAW76638.1
CH471091 Genomic DNA Translation: EAW76642.1
BC033862 mRNA Translation: AAH33862.1
AF280107 Genomic DNA Translation: AAG32288.1
L35912 Genomic DNA Translation: AAB00083.1
S74699 Genomic DNA Translation: AAD14157.1
S74700 Genomic DNA Translation: AAD14158.1
CCDSiCCDS55134.1 [P20815-2]
CCDS5672.1 [P20815-1]
PIRiA34101
A60558
RefSeqiNP_000768.1, NM_000777.4 [P20815-1]
NP_001177413.1, NM_001190484.2 [P20815-2]
UniGeneiHs.571258

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5VEUX-ray2.91A/B/C/D/E/F/G/H/I/J/K/L24-497[»]
ProteinModelPortaliP20815
SMRiP20815
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107949, 7 interactors
IntActiP20815, 4 interactors
STRINGi9606.ENSP00000222982

Chemistry databases

BindingDBiP20815
ChEMBLiCHEMBL3019
DrugBankiDB00802 Alfentanil
DB00404 Alprazolam
DB06403 Ambrisentan
DB01118 Amiodarone
DB00321 Amitriptyline
DB00381 Amlodipine
DB00701 Amprenavir
DB06605 Apixaban
DB00673 Aprepitant
DB00278 Argatroban
DB01238 Aripiprazole
DB06413 Armodafinil
DB06697 Artemether
DB00637 Astemizole
DB01076 Atorvastatin
DB06626 Axitinib
DB00972 Azelastine
DB04957 Azimilide
DB00394 Beclomethasone dipropionate
DB08873 Boceprevir
DB08870 Brentuximab vedotin
DB00921 Buprenorphine
DB00490 Buspirone
DB06772 Cabazitaxel
DB00201 Caffeine
DB00564 Carbamazepine
DB00439 Cerivastatin
DB06419 Cethromycin
DB00446 Chloramphenicol
DB00608 Chloroquine
DB01114 Chlorphenamine
DB01166 Cilostazol
DB00501 Cimetidine
DB00537 Ciprofloxacin
DB00604 Cisapride
DB01211 Clarithromycin
DB00575 Clonidine
DB00758 Clopidogrel
DB05239 Cobimetinib
DB00907 Cocaine
DB00318 Codeine
DB08865 Crizotinib
DB00531 Cyclophosphamide
DB00091 Cyclosporine
DB09102 Daclatasvir
DB00250 Dapsone
DB01254 Dasatinib
DB00694 Daunorubicin
DB00705 Delavirdine
DB01234 Dexamethasone
DB04856 Dexloxiglumide
DB00514 Dextromethorphan
DB00829 Diazepam
DB00343 Diltiazem
DB00822 Disulfiram
DB01248 Docetaxel
DB08930 Dolutegravir
DB01184 Domperidone
DB01126 Dutasteride
DB08899 Enzalutamide
DB00700 Eplerenone
DB00530 Erlotinib
DB00783 Estradiol
DB00655 Estrone
DB00593 Ethosuximide
DB00773 Etoposide
DB01023 Felodipine
DB00813 Fentanyl
DB01216 Finasteride
DB00196 Fluconazole
DB00472 Fluoxetine
DB00499 Flutamide
DB00588 Fluticasone Propionate
DB01095 Fluvastatin
DB00176 Fluvoxamine
DB00317 Gefitinib
DB06730 Gestodene
DB00889 Granisetron
DB01218 Halofantrine
DB00502 Haloperidol
DB00741 Hydrocortisone
DB06789 Hydroxyprogesterone caproate
DB09053 Ibrutinib
DB01181 Ifosfamide
DB04946 Iloperidone
DB00619 Imatinib
DB00224 Indinavir
DB00762 Irinotecan
DB01167 Itraconazole
DB01026 Ketoconazole
DB01259 Lapatinib
DB00528 Lercanidipine
DB01227 Levomethadyl Acetate
DB00281 Lidocaine
DB00678 Losartan
DB00227 Lovastatin
DB00333 Methadone
DB01388 Mibefradil
DB00683 Midazolam
DB00834 Mifepristone
DB00745 Modafinil
DB00688 Mycophenolate mofetil
DB00731 Nateglinide
DB01149 Nefazodone
DB00220 Nelfinavir
DB00238 Nevirapine
DB00622 Nicardipine
DB01115 Nifedipine
DB00393 Nimodipine
DB00401 Nisoldipine
DB01054 Nitrendipine
DB00717 Norethisterone
DB01059 Norfloxacin
DB00540 Nortriptyline
DB00904 Ondansetron
DB00842 Oxazepam
DB00776 Oxcarbazepine
DB01062 Oxybutynin
DB00497 Oxycodone
DB01229 Paclitaxel
DB01267 Paliperidone
DB09297 Paritaprevir
DB00738 Pentamidine
DB08883 Perampanel
DB00780 Phenelzine
DB01174 Phenobarbital
DB00252 Phenytoin
DB01100 Pimozide
DB08901 Ponatinib
DB00175 Pravastatin
DB01058 Praziquantel
DB00396 Progesterone
DB00571 Propranolol
DB01224 Quetiapine
DB01103 Quinacrine
DB00468 Quinine
DB00863 Ranitidine
DB00206 Reserpine
DB01045 Rifampicin
DB01201 Rifapentine
DB00734 Risperidone
DB00503 Ritonavir
DB06228 Rivaroxaban
DB06176 Romidepsin
DB01098 Rosuvastatin
DB00938 Salmeterol
DB01232 Saquinavir
DB06335 Saxagliptin
DB06731 Seproxetine
DB00203 Sildenafil
DB00641 Simvastatin
DB00877 Sirolimus
DB00398 Sorafenib
DB00795 Sulfasalazine
DB01268 Sunitinib
DB00864 Tacrolimus
DB00675 Tamoxifen
DB00976 Telithromycin
DB06287 Temsirolimus
DB00444 Teniposide
DB00342 Terfenadine
DB00624 Testosterone
DB01041 Thalidomide
DB05773 Trastuzumab emtansine
DB00656 Trazodone
DB00755 Tretinoin
DB00897 Triazolam
DB00197 Troglitazone
DB01361 Troleandomycin
DB06267 Udenafil
DB00313 Valproic Acid
DB00862 Vardenafil
DB00661 Verapamil
DB00541 Vincristine
DB00582 Voriconazole
DB09068 Vortioxetine
DB00943 Zalcitabine
DB00962 Zaleplon
DB00246 Ziprasidone
DB00425 Zolpidem
GuidetoPHARMACOLOGYi1338
SwissLipidsiSLP:000001325

PTM databases

iPTMnetiP20815
PhosphoSitePlusiP20815

Polymorphism and mutation databases

BioMutaiCYP3A5
DMDMi117157

Proteomic databases

PaxDbiP20815
PeptideAtlasiP20815
PRIDEiP20815
ProteomicsDBi53804
53805 [P20815-2]

Protocols and materials databases

DNASUi1577
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222982; ENSP00000222982; ENSG00000106258 [P20815-1]
ENST00000439761; ENSP00000401269; ENSG00000106258 [P20815-2]
ENST00000646887; ENSP00000496704; ENSG00000106258 [P20815-2]
GeneIDi1577
KEGGihsa:1577
UCSCiuc003urq.4 human [P20815-1]

Organism-specific databases

CTDi1577
DisGeNETi1577
EuPathDBiHostDB:ENSG00000106258.13
GeneCardsiCYP3A5
HGNCiHGNC:2638 CYP3A5
HPAiHPA072245
MalaCardsiCYP3A5
MIMi605325 gene
neXtProtiNX_P20815
OpenTargetsiENSG00000106258
Orphaneti241043 Tacrolimus dose selection
PharmGKBiPA131
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0158 Eukaryota
COG2124 LUCA
GeneTreeiENSGT00900000140779
HOGENOMiHOG000082412
HOVERGENiHBG108567
InParanoidiP20815
KOiK17690
OMAiPAIAKHI
OrthoDBiEOG091G0JNC
PhylomeDBiP20815
TreeFamiTF105087

Enzyme and pathway databases

BRENDAi1.14.14.1 2681
ReactomeiR-HSA-211981 Xenobiotics
R-HSA-5423646 Aflatoxin activation and detoxification
SABIO-RKiP20815

Miscellaneous databases

ChiTaRSiCYP3A5 human
GeneWikiiCYP3A5
GenomeRNAii1577
PROiPR:P20815
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106258 Expressed in 182 organ(s), highest expression level in liver
CleanExiHS_CYP3A5
ExpressionAtlasiP20815 baseline and differential
GenevisibleiP20815 HS

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128 Cyt_P450
IPR017972 Cyt_P450_CS
IPR008072 Cyt_P450_E_CYP3A
IPR002402 Cyt_P450_E_grp-II
IPR036396 Cyt_P450_sf
PfamiView protein in Pfam
PF00067 p450, 1 hit
PRINTSiPR00464 EP450II
PR01689 EP450IICYP3A
PR00385 P450
SUPFAMiSSF48264 SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086 CYTOCHROME_P450, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCP3A5_HUMAN
AccessioniPrimary (citable) accession number: P20815
Secondary accession number(s): A4D289
, B7Z5I7, Q53WY8, Q75MV0, Q9HB56
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: September 12, 2018
This is version 186 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again