Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P20813 (CP2B6_HUMAN)

Entry version 217 (29 Sep 2021)
Sequence version 1 (01 Feb 1991)
Previous versions | rss
Add a publicationFeedback
Protein

Cytochrome P450 2B6

Gene

CYP2B6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

A cytochrome P450 monooxygenase involved in the metabolism of endocannabinoids and steroids (PubMed:21289075, PubMed:12865317).

Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the epoxidation of double bonds of arachidonoylethanolamide (anandamide) to 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling (PubMed:21289075).

Hydroxylates steroid hormones, including testosterone at C-16 and estrogens at C-2 (PubMed:21289075, PubMed:12865317).

Plays a role in the oxidative metabolism of xenobiotics, including plant lipids and drugs (PubMed:11695850, PubMed:22909231).

Acts as a 1,4-cineole 2-exo-monooxygenase (PubMed:11695850).

4 Publications

Allele 2B6*9: Has low affinity for anandamide and can only produce 11,12 EpETrE-EAs.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

heme3 Publications

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=360 µM for 1,4-cineole1 Publication
  2. KM=13.3 µM for testosterone (16-alpha-hydroxylation)1 Publication
  3. KM=27.7 µM for testosterone (16-beta-hydroxylation)1 Publication
  4. KM=3.6 µM for N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine (14,15-epoxidation)1 Publication
  5. KM=1.32 µM for N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine (11,12-epoxidation)1 Publication
  6. KM=1.21 µM for N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine (8,9-epoxidation)1 Publication
  1. Vmax=3.4 nmol/min/nmol enzyme toward 1,4-cineole1 Publication
  2. Vmax=2.04 pmol/min/pmol enzyme toward N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine (14,15-epoxidation)1 Publication
  3. Vmax=7.56 pmol/min/pmol enzyme toward N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine (11,12-epoxidation)1 Publication
  4. Vmax=3.12 pmol/min/pmol enzyme toward N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine (8,9-epoxidation)1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi436Iron (heme axial ligand)1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
Biological processLipid metabolism
LigandHeme, Iron, Metal-binding, NADP

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS09587-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		1.14.14.1, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P20813

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-211935, Fatty acids
R-HSA-211981, Xenobiotics
R-HSA-211999, CYP2E1 reactions

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P20813

SIGNOR Signaling Network Open Resource

More...SIGNORi		P20813

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001346

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytochrome P450 2B6 (EC:1.14.13.-2 Publications)
Alternative name(s):
1,4-cineole 2-exo-monooxygenase1 Publication
CYPIIB6
Cytochrome P450 IIB11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CYP2B61 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:2615, CYP2B6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		123930, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P20813

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000197408

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		1555

MalaCards human disease database

More...MalaCardsi		CYP2B6
MIMi614546, phenotype

Open Targets

More...OpenTargetsi		ENSG00000197408

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		240869, Efavirenz toxicity

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA123

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P20813, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4729

Drug and drug target database

More...DrugBanki		DB08369, 1-(biphenyl-4-ylmethyl)-1H-imidazole
DB02974, 4-(4-Chlorophenyl)Imidazole
DB11932, Abametapir
DB12001, Abemaciclib
DB00321, Amitriptyline
DB00381, Amlodipine
DB00701, Amprenavir
DB01435, Antipyrine
DB00714, Apomorphine
DB06413, Armodafinil
DB06697, Artemether
DB13132, Artemisinin
DB11586, Asunaprevir
DB01076, Atorvastatin
DB00972, Azelastine
DB04975, Banoxantrone
DB00865, Benzphetamine
DB00443, Betamethasone
DB04794, Bifonazole
DB05541, Brivaracetam
DB01222, Budesonide
DB01156, Bupropion
DB00564, Carbamazepine
DB06119, Cenobamate
DB00439, Cerivastatin
DB00568, Cinnarizine
DB00604, Cisapride
DB00515, Cisplatin
DB12499, Clascoterone
DB00349, Clobazam
DB06470, Clomethiazole
DB00758, Clopidogrel
DB01559, Clotiazepam
DB00257, Clotrimazole
DB01394, Colchicine
DB05219, Crisaborole
DB08865, Crizotinib
DB11672, Curcumin
DB14635, Curcumin sulfate
DB04664, Cyclohexyl-pentyl-maltoside
DB00531, Cyclophosphamide
DB08912, Dabrafenib
DB01151, Desipramine
DB01234, Dexamethasone
DB14649, Dexamethasone acetate
DB04856, Dexloxiglumide
DB00514, Dextromethorphan
DB00829, Diazepam
DB00586, Diclofenac
DB01184, Domperidone
DB00997, Doxorubicin
DB00625, Efavirenz
DB15444, Elexacaftor
DB13874, Enasidenib
DB08899, Enzalutamide
DB00751, Epinastine
DB11823, Esketamine
DB00655, Estrone
DB00898, Ethanol
DB01466, Ethylmorphine
DB00574, Fenfluramine
DB01544, Flunitrazepam
DB00472, Fluoxetine
DB01095, Fluvastatin
DB00176, Fluvoxamine
DB01320, Fosphenytoin
DB01159, Halothane
DB00956, Hydrocodone
DB00741, Hydrocortisone
DB09054, Idelalisib
DB01181, Ifosfamide
DB00458, Imipramine
DB00762, Irinotecan
DB11633, Isavuconazole
DB00753, Isoflurane
DB11757, Istradefylline
DB01167, Itraconazole
DB14568, Ivosidenib
DB09570, Ixazomib
DB01221, Ketamine
DB06738, Ketobemidone
DB01026, Ketoconazole
DB11951, Lemborexant
DB09078, Lenvatinib
DB12070, Letermovir
DB00281, Lidocaine
DB00836, Loperamide
DB01601, Lopinavir
DB00455, Loratadine
DB04871, Lorcaserin
DB12130, Lorlatinib
DB09280, Lumacaftor
DB00772, Malathion
DB09238, Manidipine
DB01043, Memantine
DB00454, Meperidine
DB00532, Mephenytoin
DB04817, Metamizole
DB00333, Methadone
DB00763, Methimazole
DB01028, Methoxyflurane
DB09241, Methylene blue
DB00849, Methylphenobarbital
DB00959, Methylprednisolone
DB06710, Methyltestosterone
DB00379, Mexiletine
DB06148, Mianserin
DB01110, Miconazole
DB06595, Midostaurin
DB00745, Modafinil
DB00220, Nelfinavir
DB00238, Nevirapine
DB00622, Nicardipine
DB00184, Nicotine
DB01115, Nifedipine
DB04868, Nilotinib
DB00435, Nitric Oxide
DB00957, Norgestimate
DB09074, Olaparib
DB01173, Orphenadrine
DB11837, Osilodrostat
DB04938, Ospemifene
DB00715, Paroxetine
DB08883, Perampanel
DB01074, Perhexiline
DB04930, Permethrin
DB12978, Pexidartinib
DB03575, Phencyclidine
DB01174, Phenobarbital
DB00252, Phenytoin
DB13941, Piperaquine
DB11642, Pitolisant
DB06209, Prasugrel
DB14631, Prednisolone phosphate
DB00635, Prednisone
DB01069, Promethazine
DB00818, Propofol
DB01589, Quazepam
DB00908, Quinidine
DB00481, Raloxifene
DB08896, Regorafenib
DB11853, Relugolix
DB00615, Rifabutin
DB01045, Rifampicin
DB11753, Rifamycin
DB01201, Rifapentine
DB08864, Rilpivirine
DB00503, Ritonavir
DB06176, Romidepsin
DB00296, Ropivacaine
DB00778, Roxithromycin
DB06654, Safinamide
DB01037, Selegiline
DB06739, Seratrodast
DB01104, Sertraline
DB01236, Sevoflurane
DB00641, Simvastatin
DB00398, Sorafenib
DB06729, Sulfaphenazole
DB01138, Sulfinpyrazone
DB00675, Tamoxifen
DB00231, Temazepam
DB00624, Testosterone
DB13943, Testosterone cypionate
DB13944, Testosterone enanthate
DB13946, Testosterone undecanoate
DB04572, Thiotepa
DB00208, Ticlopidine
DB06137, Tirbanibulin
DB00193, Tramadol
DB00755, Tretinoin
DB12245, Triclabendazole
DB12808, Trifarotene
DB00197, Troglitazone
DB00313, Valproic acid
DB11613, Velpatasvir
DB08881, Vemurafenib
DB00661, Verapamil
DB00582, Voriconazole
DB09068, Vortioxetine
DB14975, Voxelotor
DB15035, Zanubrutinib

DrugCentral

More...DrugCentrali		P20813

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1324

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CYP2B6

Domain mapping of disease mutations (DMDM)

More...DMDMi		117205

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000516831 – 491Cytochrome P450 2B6Add BLAST491

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei128Phosphoserine; by PKABy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation is accompanied by a decrease in enzyme activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P20813

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P20813

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P20813

PeptideAtlas

More...PeptideAtlasi		P20813

PRoteomics IDEntifications database

More...PRIDEi		P20813

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		5366
53803 [P20813-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P20813

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P20813

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in liver, lung and heart right ventricle.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By phenobarbital.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000197408, Expressed in liver and 93 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P20813, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P20813, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000197408, Tissue enriched (liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107933, 5 interactors

Protein interaction database and analysis system

More...IntActi		P20813, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000324648

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P20813

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P20813, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1491
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P20813

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P20813

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0156, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157162

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001570_22_3_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P20813

Identification of Orthologs from Complete Genome Data

More...OMAi		TNIGTPH

Database of Orthologous Groups

More...OrthoDBi		702827at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P20813

TreeFam database of animal gene trees

More...TreeFami		TF352043

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.630.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR002401, Cyt_P450_E_grp-I
IPR008068, Cyt_P450_E_grp-I_CYP2B-like
IPR036396, Cyt_P450_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00067, p450, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00463, EP450I
PR01685, EP450ICYP2B
PR00385, P450

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48264, SSF48264, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P20813-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELSVLLFLA LLTGLLLLLV QRHPNTHDRL PPGPRPLPLL GNLLQMDRRG 
        60         70         80         90        100
LLKSFLRFRE KYGDVFTVHL GPRPVVMLCG VEAIREALVD KAEAFSGRGK 
       110        120        130        140        150
IAMVDPFFRG YGVIFANGNR WKVLRRFSVT TMRDFGMGKR SVEERIQEEA 
       160        170        180        190        200
QCLIEELRKS KGALMDPTFL FQSITANIIC SIVFGKRFHY QDQEFLKMLN 
       210        220        230        240        250
LFYQTFSLIS SVFGQLFELF SGFLKYFPGA HRQVYKNLQE INAYIGHSVE 
       260        270        280        290        300
KHRETLDPSA PKDLIDTYLL HMEKEKSNAH SEFSHQNLNL NTLSLFFAGT 
       310        320        330        340        350
ETTSTTLRYG FLLMLKYPHV AERVYREIEQ VIGPHRPPEL HDRAKMPYTE 
       360        370        380        390        400
AVIYEIQRFS DLLPMGVPHI VTQHTSFRGY IIPKDTEVFL ILSTALHDPH 
       410        420        430        440        450
YFEKPDAFNP DHFLDANGAL KKTEAFIPFS LGKRICLGEG IARAELFLFF 
       460        470        480        490 
TTILQNFSMA SPVAPEDIDL TPQECGVGKI PPTYQIRFLP R
Length:491
Mass (Da):56,278
Last modified:February 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB9799164BE8FBF1D
GO
Isoform 2 (identifier: P20813-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLR → MRCMLTNSHPWCGCDWQ
     162-321: Missing.

Show »
Length:291
Mass (Da):33,385
Checksum:iA4B40F24ED632B8D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0QZJ2M0QZJ2_HUMAN
Cytochrome P450 2B6
CYP2B6
255Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFA4A0A2R8YFA4_HUMAN
Cytochrome P450 2B6
CYP2B6
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti146I → T in AAF13602 (Ref. 2) Curated1
Sequence conflicti238L → P in AAF13602 (Ref. 2) Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Variability among CYP2B6 alleles may account for differential metabolism of endogenous steroids and endocannabinoids among individuals. For 16-alpha hydroxylation of testosterone, Vmax/Km values between alleles decrease in the following order: 2B6*1 > 2B6*6 > 2B6*9 > 2B7*4. For 16-beta hydroxylation of testosterone, 2B6*6 has the highest catalytic efficiency. For anandamide metabolism, 2B6*6 and 2B6*9 alleles show significantly lower rates of epoxidation (PubMed:21289075). Genetic variations in CYP2B6 are responsible for poor metabolism of efavirenz and, therefore, susceptibility to efavirenz toxicity in the central nervous system [MIMi:614546]. Efavirenz is a non-nucleoside reverse transcriptase inhibitor frequently prescribed with 2 nucleoside reverse transcriptase inhibitors as initial therapy for human immunodeficiency virus (HIV) infection. Up to half of patients treated with efavirenz, experience side effects in the central nervous system, including dizziness, insomnia, impaired concentration, somnolence, and abnormal dreams. Severe depression, aggressive behavior, and paranoid or manic reactions may also occur, depending on efavirenz concentration in the plasma. Patients homozygous for 2B6*6 have significantly higher plasma efavirenz levels when compared to 2B6*6 heterozygous ones (PubMed:15622315, PubMed:15194512, PubMed:20639527).4 Publications

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02356321Q → L in allele CYP2B6*10. 1 PublicationCorresponds to variant dbSNP:rs34883432Ensembl.1
Natural variantiVAR_01692722R → C in allele CYP2B6*2 and allele CYP2B6*10. 6 PublicationsCorresponds to variant dbSNP:rs8192709Ensembl.1
Natural variantiVAR_02520626T → S1 PublicationCorresponds to variant dbSNP:rs33973337Ensembl.1
Natural variantiVAR_02520728D → G1 PublicationCorresponds to variant dbSNP:rs33980385Ensembl.1
Natural variantiVAR_03381929R → P. Corresponds to variant dbSNP:rs34284776Ensembl.1
Natural variantiVAR_02520829R → S1 PublicationCorresponds to variant dbSNP:rs33926104Ensembl.1
Natural variantiVAR_02356446M → V in allele CYP2B6*11. 1 PublicationCorresponds to variant dbSNP:rs35303484Ensembl.1
Natural variantiVAR_02356599G → E in allele CYP2B6*12. 1 PublicationCorresponds to variant dbSNP:rs36060847Ensembl.1
Natural variantiVAR_016948139K → E in allele CYP2B6*8 and allele CYP2B6*13. 2 PublicationsCorresponds to variant dbSNP:rs12721655Ensembl.1
Natural variantiVAR_023566140R → Q in allele CYP2B6*14. 1 PublicationCorresponds to variant dbSNP:rs35773040Ensembl.1
Natural variantiVAR_016924167P → A2 PublicationsCorresponds to variant dbSNP:rs3826711Ensembl.1
Natural variantiVAR_016925172Q → H in allele CYP2B6*6, allele CYP2B6*7, allele CYP2B6*9 and allele CYP2B6*13. 8 PublicationsCorresponds to variant dbSNP:rs3745274EnsemblClinVar.1
Natural variantiVAR_016928259S → R in allele CYP2B6*3. 2 PublicationsCorresponds to variant dbSNP:rs45482602Ensembl.1
Natural variantiVAR_016926262K → R in allele CYP2B6*4, allele CYP2B6*6, allele CYP2B6*7 and allele CYP2B6*13; slight decrease in activity. 5 PublicationsCorresponds to variant dbSNP:rs2279343EnsemblClinVar.1
Natural variantiVAR_025209289N → K1 PublicationCorresponds to variant dbSNP:rs34277950Ensembl.1
Natural variantiVAR_025210306T → S1 PublicationCorresponds to variant dbSNP:rs34698757Ensembl.1
Natural variantiVAR_024716328I → T2 PublicationsCorresponds to variant dbSNP:rs28399499EnsemblClinVar.1
Natural variantiVAR_023567391I → N in allele CYP2B6*15. 1 PublicationCorresponds to variant dbSNP:rs35979566Ensembl.1
Natural variantiVAR_016929487R → C in allele CYP2B6*5 and allele CYP2B6*7. 6 PublicationsCorresponds to variant dbSNP:rs3211371Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0555711 – 57MELSV…KSFLR → MRCMLTNSHPWCGCDWQ in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_055572162 – 321Missing in isoform 2. 1 PublicationAdd BLAST160

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M29874 mRNA Translation: AAA52144.1
AF182277 mRNA Translation: AAF13602.1
AK301620 mRNA Translation: BAG63105.1
DQ298753 Genomic DNA Translation: ABB84469.1
AC023172 Genomic DNA Translation: AAF32444.1
AC011541 Genomic DNA No translation available.
X13494 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12570.1 [P20813-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A32969

NCBI Reference Sequences

More...RefSeqi		NP_000758.1, NM_000767.4 [P20813-1]
XP_011524852.1, XM_011526550.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000324071; ENSP00000324648; ENSG00000197408 [P20813-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1555

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1555

UCSC genome browser

More...UCSCi		uc002opr.2, human [P20813-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP2B6 alleles

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29874 mRNA Translation: AAA52144.1
AF182277 mRNA Translation: AAF13602.1
AK301620 mRNA Translation: BAG63105.1
DQ298753 Genomic DNA Translation: ABB84469.1
AC023172 Genomic DNA Translation: AAF32444.1
AC011541 Genomic DNA No translation available.
X13494 mRNA No translation available.
CCDSiCCDS12570.1 [P20813-1]
PIRiA32969
RefSeqiNP_000758.1, NM_000767.4 [P20813-1]
XP_011524852.1, XM_011526550.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3IBDX-ray2.00A30-491[»]
3QOAX-ray2.10A27-491[»]
3QU8X-ray2.80A/B/C/D/E/F27-491[»]
3UA5X-ray2.80A/B27-491[»]
4I91X-ray2.00A27-491[»]
4RQLX-ray2.10A/B27-491[»]
4RRTX-ray2.20A/B27-491[»]
4ZV8X-ray2.24A30-491[»]
5UAPX-ray2.03A/B20-491[»]
5UDAX-ray1.93A/B20-491[»]
5UECX-ray2.27A20-491[»]
5UFGX-ray1.76A20-491[»]
5WBGX-ray2.99A/B/C/D/E/F20-491[»]
SMRiP20813
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107933, 5 interactors
IntActiP20813, 5 interactors
STRINGi9606.ENSP00000324648

Chemistry databases

BindingDBiP20813
ChEMBLiCHEMBL4729
DrugBankiDB08369, 1-(biphenyl-4-ylmethyl)-1H-imidazole
DB02974, 4-(4-Chlorophenyl)Imidazole
DB11932, Abametapir
DB12001, Abemaciclib
DB00321, Amitriptyline
DB00381, Amlodipine
DB00701, Amprenavir
DB01435, Antipyrine
DB00714, Apomorphine
DB06413, Armodafinil
DB06697, Artemether
DB13132, Artemisinin
DB11586, Asunaprevir
DB01076, Atorvastatin
DB00972, Azelastine
DB04975, Banoxantrone
DB00865, Benzphetamine
DB00443, Betamethasone
DB04794, Bifonazole
DB05541, Brivaracetam
DB01222, Budesonide
DB01156, Bupropion
DB00564, Carbamazepine
DB06119, Cenobamate
DB00439, Cerivastatin
DB00568, Cinnarizine
DB00604, Cisapride
DB00515, Cisplatin
DB12499, Clascoterone
DB00349, Clobazam
DB06470, Clomethiazole
DB00758, Clopidogrel
DB01559, Clotiazepam
DB00257, Clotrimazole
DB01394, Colchicine
DB05219, Crisaborole
DB08865, Crizotinib
DB11672, Curcumin
DB14635, Curcumin sulfate
DB04664, Cyclohexyl-pentyl-maltoside
DB00531, Cyclophosphamide
DB08912, Dabrafenib
DB01151, Desipramine
DB01234, Dexamethasone
DB14649, Dexamethasone acetate
DB04856, Dexloxiglumide
DB00514, Dextromethorphan
DB00829, Diazepam
DB00586, Diclofenac
DB01184, Domperidone
DB00997, Doxorubicin
DB00625, Efavirenz
DB15444, Elexacaftor
DB13874, Enasidenib
DB08899, Enzalutamide
DB00751, Epinastine
DB11823, Esketamine
DB00655, Estrone
DB00898, Ethanol
DB01466, Ethylmorphine
DB00574, Fenfluramine
DB01544, Flunitrazepam
DB00472, Fluoxetine
DB01095, Fluvastatin
DB00176, Fluvoxamine
DB01320, Fosphenytoin
DB01159, Halothane
DB00956, Hydrocodone
DB00741, Hydrocortisone
DB09054, Idelalisib
DB01181, Ifosfamide
DB00458, Imipramine
DB00762, Irinotecan
DB11633, Isavuconazole
DB00753, Isoflurane
DB11757, Istradefylline
DB01167, Itraconazole
DB14568, Ivosidenib
DB09570, Ixazomib
DB01221, Ketamine
DB06738, Ketobemidone
DB01026, Ketoconazole
DB11951, Lemborexant
DB09078, Lenvatinib
DB12070, Letermovir
DB00281, Lidocaine
DB00836, Loperamide
DB01601, Lopinavir
DB00455, Loratadine
DB04871, Lorcaserin
DB12130, Lorlatinib
DB09280, Lumacaftor
DB00772, Malathion
DB09238, Manidipine
DB01043, Memantine
DB00454, Meperidine
DB00532, Mephenytoin
DB04817, Metamizole
DB00333, Methadone
DB00763, Methimazole
DB01028, Methoxyflurane
DB09241, Methylene blue
DB00849, Methylphenobarbital
DB00959, Methylprednisolone
DB06710, Methyltestosterone
DB00379, Mexiletine
DB06148, Mianserin
DB01110, Miconazole
DB06595, Midostaurin
DB00745, Modafinil
DB00220, Nelfinavir
DB00238, Nevirapine
DB00622, Nicardipine
DB00184, Nicotine
DB01115, Nifedipine
DB04868, Nilotinib
DB00435, Nitric Oxide
DB00957, Norgestimate
DB09074, Olaparib
DB01173, Orphenadrine
DB11837, Osilodrostat
DB04938, Ospemifene
DB00715, Paroxetine
DB08883, Perampanel
DB01074, Perhexiline
DB04930, Permethrin
DB12978, Pexidartinib
DB03575, Phencyclidine
DB01174, Phenobarbital
DB00252, Phenytoin
DB13941, Piperaquine
DB11642, Pitolisant
DB06209, Prasugrel
DB14631, Prednisolone phosphate
DB00635, Prednisone
DB01069, Promethazine
DB00818, Propofol
DB01589, Quazepam
DB00908, Quinidine
DB00481, Raloxifene
DB08896, Regorafenib
DB11853, Relugolix
DB00615, Rifabutin
DB01045, Rifampicin
DB11753, Rifamycin
DB01201, Rifapentine
DB08864, Rilpivirine
DB00503, Ritonavir
DB06176, Romidepsin
DB00296, Ropivacaine
DB00778, Roxithromycin
DB06654, Safinamide
DB01037, Selegiline
DB06739, Seratrodast
DB01104, Sertraline
DB01236, Sevoflurane
DB00641, Simvastatin
DB00398, Sorafenib
DB06729, Sulfaphenazole
DB01138, Sulfinpyrazone
DB00675, Tamoxifen
DB00231, Temazepam
DB00624, Testosterone
DB13943, Testosterone cypionate
DB13944, Testosterone enanthate
DB13946, Testosterone undecanoate
DB04572, Thiotepa
DB00208, Ticlopidine
DB06137, Tirbanibulin
DB00193, Tramadol
DB00755, Tretinoin
DB12245, Triclabendazole
DB12808, Trifarotene
DB00197, Troglitazone
DB00313, Valproic acid
DB11613, Velpatasvir
DB08881, Vemurafenib
DB00661, Verapamil
DB00582, Voriconazole
DB09068, Vortioxetine
DB14975, Voxelotor
DB15035, Zanubrutinib
DrugCentraliP20813
GuidetoPHARMACOLOGYi1324
SwissLipidsiSLP:000001346

PTM databases

iPTMnetiP20813
PhosphoSitePlusiP20813

Genetic variation databases

BioMutaiCYP2B6
DMDMi117205

Proteomic databases

EPDiP20813
MassIVEiP20813
PaxDbiP20813
PeptideAtlasiP20813
PRIDEiP20813
ProteomicsDBi5366
53803 [P20813-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		30684, 364 antibodies

The DNASU plasmid repository

More...DNASUi		1555

Genome annotation databases

EnsembliENST00000324071; ENSP00000324648; ENSG00000197408 [P20813-1]
GeneIDi1555
KEGGihsa:1555
UCSCiuc002opr.2, human [P20813-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1555
DisGeNETi1555

GeneCards: human genes, protein and diseases

More...GeneCardsi		CYP2B6
HGNCiHGNC:2615, CYP2B6
HPAiENSG00000197408, Tissue enriched (liver)
MalaCardsiCYP2B6
MIMi123930, gene
614546, phenotype
neXtProtiNX_P20813
OpenTargetsiENSG00000197408
Orphaneti240869, Efavirenz toxicity
PharmGKBiPA123
VEuPathDBiHostDB:ENSG00000197408

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0156, Eukaryota
GeneTreeiENSGT00940000157162
HOGENOMiCLU_001570_22_3_1
InParanoidiP20813
OMAiTNIGTPH
OrthoDBi702827at2759
PhylomeDBiP20813
TreeFamiTF352043

Enzyme and pathway databases

BioCyciMetaCyc:HS09587-MONOMER
BRENDAi1.14.14.1, 2681
PathwayCommonsiP20813
ReactomeiR-HSA-211935, Fatty acids
R-HSA-211981, Xenobiotics
R-HSA-211999, CYP2E1 reactions
SABIO-RKiP20813
SIGNORiP20813

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		1555, 4 hits in 1004 CRISPR screens
EvolutionaryTraceiP20813

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CYP2B6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1555
PharosiP20813, Tchem

Protein Ontology

More...PROi		PR:P20813
RNActiP20813, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000197408, Expressed in liver and 93 other tissues
ExpressionAtlasiP20813, baseline and differential
GenevisibleiP20813, HS

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR002401, Cyt_P450_E_grp-I
IPR008068, Cyt_P450_E_grp-I_CYP2B-like
IPR036396, Cyt_P450_sf
PfamiView protein in Pfam
PF00067, p450, 1 hit
PRINTSiPR00463, EP450I
PR01685, EP450ICYP2B
PR00385, P450
SUPFAMiSSF48264, SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCP2B6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P20813
Secondary accession number(s): B4DWP3, Q2V565, Q9UK46
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: September 29, 2021
This is version 217 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again