CYP2B6

Functionⁱ

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,4-cineole 2-exo-monooxygenase.4 Publications

Catalytic activityⁱ

1,4-cineole + NADPH + O₂ = 2-exo-hydroxy-1,4-cineole + NADP⁺ + H₂O.1 Publication

Cofactorⁱ

heme3 Publications

Kineticsⁱ

K_M=
360 µM for 1,4-cineole
1 Publication
Manual assertion based on experiment inⁱ
- Ref.8
  "Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
  Miyazawa M., Shindo M., Shimada T.
  Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]
  Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES.

V_max=
3.4 nmol/min/nmol enzyme toward 2-exo-hydroxy-1,4-cineole
1 Publication
Manual assertion based on experiment inⁱ
- Ref.8
  "Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
  Miyazawa M., Shindo M., Shimada T.
  Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]
  Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES.

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Metal bindingⁱ	436	Iron (heme axial ligand)		1

GO - Molecular functionⁱ

arachidonic acid epoxygenase activity Source: GO_Central
heme binding
Source: UniProtKB
Inferred from direct assayⁱ
- 20061448
iron ion binding Source: InterPro
monooxygenase activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 19651758
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Source: InterPro
steroid hydroxylase activity Source: GO_Central

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular ketone metabolic process
Source: BHF-UCL
Inferred from direct assayⁱ
- 19651758
drug metabolic process
Source: BHF-UCL
Inferred from direct assayⁱ
- 19651758
epoxygenase P450 pathway Source: GO_Central
exogenous drug catabolic process
Source: BHF-UCL
Inferred from direct assayⁱ
- 19029318
oxidation-reduction process
Source: BHF-UCL
Inferred from direct assayⁱ
- 19651758
steroid metabolic process
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 18356043
xenobiotic metabolic process
Source: UniProtKB
Inferred from direct assayⁱ
- 20061448

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Monooxygenase, Oxidoreductase
Ligand	Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS09587-MONOMER
BRENDAⁱ	1.14.14.1 2681
Reactomeⁱ	R-HSA-211935 Fatty acids R-HSA-211981 Xenobiotics R-HSA-211999 CYP2E1 reactions
SABIO-RKⁱ	P20813
SIGNORⁱ	P20813

Chemistry databases

SwissLipidsⁱ	SLP:000001346

SwissLipidsⁱ

SLP:000001346

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Cytochrome P450 2B6 (EC:1.14.13.-) Alternative name(s): 1,4-cineole 2-exo-monooxygenase CYPIIB6 Cytochrome P450 IIB1
Gene namesⁱ	Name:CYP2B6
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 19

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000197408.8
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:2615 CYP2B6
MIMⁱ	123930 gene
neXtProtⁱ	NX_P20813

Keywords - Cellular componentⁱ

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	1555
MalaCards human disease database More...MalaCardsⁱ	CYP2B6
MIMⁱ	614546 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000197408
Orphanetⁱ	240869 Efavirenz toxicity
PharmGKBⁱ	PA123

Chemistry databases

ChEMBLⁱ	CHEMBL4729
Drug and drug target database More...DrugBankⁱ	DB08369 1-(biphenyl-4-ylmethyl)-1H-imidazole DB02974 4-(4-Chlorophenyl)Imidazole DB00321 Amitriptyline DB00381 Amlodipine DB00701 Amprenavir DB01435 Antipyrine DB06413 Armodafinil DB06697 Artemether DB01076 Atorvastatin DB00972 Azelastine DB04975 Banoxantrone DB00865 Benzphetamine DB06770 Benzyl alcohol DB04794 Bifonazole DB00835 Brompheniramine DB01156 Bupropion DB00564 Carbamazepine DB00748 Carbinoxamine DB00439 Cerivastatin DB00169 Cholecalciferol DB00568 Cinnarizine DB00604 Cisapride DB00515 Cisplatin DB00215 Citalopram DB00349 Clobazam DB00636 Clofibrate DB00758 Clopidogrel DB01559 Clotiazepam DB00257 Clotrimazole DB01394 Colchicine DB05219 Crisaborole DB08865 Crizotinib DB04664 Cyclohexyl-pentyl-maltoside DB00531 Cyclophosphamide DB01151 Desipramine DB01234 Dexamethasone DB00514 Dextromethorphan DB00829 Diazepam DB00586 Diclofenac DB01075 Diphenhydramine DB01184 Domperidone DB00997 Doxorubicin DB00625 Efavirenz DB08899 Enzalutamide DB00751 Epinastine DB00199 Erythromycin DB00655 Estrone DB00898 Ethanol DB01466 Ethylmorphine DB04841 Flunarizine DB01544 Flunitrazepam DB00472 Fluoxetine DB01095 Fluvastatin DB00176 Fluvoxamine DB01320 Fosphenytoin DB01159 Halothane DB09054 Idelalisib DB01181 Ifosfamide DB00458 Imipramine DB00762 Irinotecan DB00753 Isoflurane DB01167 Itraconazole DB09570 Ixazomib DB01221 Ketamine DB06738 Ketobemidone DB01026 Ketoconazole DB00281 Lidocaine DB00836 Loperamide DB01601 Lopinavir DB04871 Lorcaserin DB09280 Lumacaftor DB00772 Malathion DB01043 Memantine DB00532 Mephenytoin DB04817 Metamizole DB00333 Methadone DB00763 Methimazole DB01028 Methoxyflurane DB00849 Methylphenobarbital DB06710 Methyltestosterone DB00379 Mexiletine DB06148 Mianserin DB01110 Miconazole DB00683 Midazolam DB00745 Modafinil DB00220 Nelfinavir DB00238 Nevirapine DB00622 Nicardipine DB00184 Nicotine DB01115 Nifedipine DB04868 Nilotinib DB00435 Nitric Oxide DB09074 Olaparib DB01173 Orphenadrine DB04938 Ospemifene DB00715 Paroxetine DB01074 Perhexiline DB04930 Permethrin DB00850 Perphenazine DB00454 Pethidine DB03575 Phencyclidine DB01174 Phenobarbital DB00252 Phenytoin DB06209 Prasugrel DB00794 Primidone DB01069 Promethazine DB00818 Propofol DB01589 Quazepam DB00908 Quinidine DB00481 Raloxifene DB08896 Regorafenib DB01045 Rifampicin DB08864 Rilpivirine DB00503 Ritonavir DB06176 Romidepsin DB00296 Ropivacaine DB00778 Roxithromycin DB01037 Selegiline DB01104 Sertraline DB01236 Sevoflurane DB00641 Simvastatin DB00398 Sorafenib DB06729 Sulfaphenazole DB01138 Sulfinpyrazone DB00675 Tamoxifen DB00231 Temazepam DB00624 Testosterone DB04572 Thiotepa DB00208 Ticlopidine DB00193 Tramadol DB00755 Tretinoin DB00197 Troglitazone DB00313 Valproic Acid DB00285 Venlafaxine DB00661 Verapamil DB09068 Vortioxetine
IUPHAR/BPS Guide to PHARMACOLOGY More...GuidetoPHARMACOLOGYⁱ	1324

Polymorphism and mutation databases

BioMutaⁱ	CYP2B6
DMDMⁱ	117205

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000051683	1 – 491	Cytochrome P450 2B6Add BLAST		491

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	128	Phosphoserine; by PKABy similarity		1

Post-translational modificationⁱ

Phosphorylation is accompanied by a decrease in enzyme activity.By similarity

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	P20813
PaxDbⁱ	P20813
PeptideAtlas More...PeptideAtlasⁱ	P20813
PRIDEⁱ	P20813
ProteomicsDBⁱ	53803

PTM databases

iPTMnetⁱ	P20813
PhosphoSitePlusⁱ	P20813

Expressionⁱ

Tissue specificityⁱ

Expressed in liver, lung and heart right ventricle.1 Publication

Inductionⁱ

By phenobarbital.

Gene expression databases

Bgeeⁱ	ENSG00000197408 Expressed in 75 organ(s), highest expression level in right lobe of liver
CleanExⁱ	HS_CYP2B6
ExpressionAtlasⁱ	P20813 baseline and differential
Genevisibleⁱ	P20813 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB033866 HPA048124 HPA062973

HPAⁱ

CAB033866
HPA048124
HPA062973

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	107933, 4 interactors
STRINGⁱ	9606.ENSP00000324648

Chemistry databases

BindingDBⁱ

P20813

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Turnⁱ	38 – 40	Combined sources	3
Helixⁱ	43 – 45	Combined sources	3
Helixⁱ	51 – 62	Combined sources	12
Beta strandⁱ	64 – 70	Combined sources	7
Beta strandⁱ	73 – 78	Combined sources	6
Helixⁱ	80 – 88	Combined sources	9
Turnⁱ	89 – 91	Combined sources	3
Helixⁱ	92 – 95	Combined sources	4
Turnⁱ	102 – 104	Combined sources	3
Helixⁱ	105 – 108	Combined sources	4
Turnⁱ	113 – 115	Combined sources	3
Helixⁱ	118 – 131	Combined sources	14
Turnⁱ	135 – 137	Combined sources	3
Helixⁱ	142 – 158	Combined sources	17
Turnⁱ	159 – 162	Combined sources	4
Helixⁱ	168 – 183	Combined sources	16
Helixⁱ	193 – 210	Combined sources	18
Helixⁱ	212 – 224	Combined sources	13
Helixⁱ	230 – 255	Combined sources	26
Helixⁱ	264 – 274	Combined sources	11
Turnⁱ	275 – 277	Combined sources	3
Beta strandⁱ	278 – 280	Combined sources	3
Helixⁱ	285 – 316	Combined sources	32
Helixⁱ	318 – 331	Combined sources	14
Beta strandⁱ	334 – 336	Combined sources	3
Helixⁱ	340 – 345	Combined sources	6
Helixⁱ	347 – 360	Combined sources	14
Beta strandⁱ	375 – 377	Combined sources	3
Beta strandⁱ	380 – 382	Combined sources	3
Beta strandⁱ	387 – 390	Combined sources	4
Helixⁱ	392 – 396	Combined sources	5
Turnⁱ	399 – 401	Combined sources	3
Beta strandⁱ	402 – 404	Combined sources	3
Helixⁱ	410 – 413	Combined sources	4
Helixⁱ	432 – 434	Combined sources	3
Helixⁱ	439 – 456	Combined sources	18
Beta strandⁱ	457 – 460	Combined sources	4
Helixⁱ	465 – 467	Combined sources	3
Beta strandⁱ	473 – 480	Combined sources	8
Beta strandⁱ	486 – 490	Combined sources	5

Show more details

3D structure databases

ProteinModelPortalⁱ	P20813
SMRⁱ	P20813
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P20813

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGⁱ	KOG0156 Eukaryota COG2124 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00880000137861
HOGENOMⁱ	HOG000036992
HOVERGENⁱ	HBG015789
InParanoidⁱ	P20813
KEGG Orthology (KO) More...KOⁱ	K17709
OMAⁱ	HTSFRGY
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0BT8
PhylomeDBⁱ	P20813
TreeFamⁱ	TF352043

Family and domain databases

Gene3Dⁱ	1.10.630.10, 1 hit
InterProⁱ	View protein in InterPro IPR001128 Cyt_P450 IPR017972 Cyt_P450_CS IPR002401 Cyt_P450_E_grp-I IPR008068 Cyt_P450_E_grp-I_CYP2B-like IPR036396 Cyt_P450_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00067 p450, 1 hit
PRINTSⁱ	PR00463 EP450I PR01685 EP450ICYP2B PR00385 P450
SUPFAMⁱ	SSF48264 SSF48264, 1 hit
PROSITEⁱ	View protein in PROSITE PS00086 CYTOCHROME_P450, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: P20813-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELSVLLFLA LLTGLLLLLV QRHPNTHDRL PPGPRPLPLL GNLLQMDRRG 
        60         70         80         90        100
LLKSFLRFRE KYGDVFTVHL GPRPVVMLCG VEAIREALVD KAEAFSGRGK 
       110        120        130        140        150
IAMVDPFFRG YGVIFANGNR WKVLRRFSVT TMRDFGMGKR SVEERIQEEA 
       160        170        180        190        200
QCLIEELRKS KGALMDPTFL FQSITANIIC SIVFGKRFHY QDQEFLKMLN 
       210        220        230        240        250
LFYQTFSLIS SVFGQLFELF SGFLKYFPGA HRQVYKNLQE INAYIGHSVE 
       260        270        280        290        300
KHRETLDPSA PKDLIDTYLL HMEKEKSNAH SEFSHQNLNL NTLSLFFAGT 
       310        320        330        340        350
ETTSTTLRYG FLLMLKYPHV AERVYREIEQ VIGPHRPPEL HDRAKMPYTE 
       360        370        380        390        400
AVIYEIQRFS DLLPMGVPHI VTQHTSFRGY IIPKDTEVFL ILSTALHDPH 
       410        420        430        440        450
YFEKPDAFNP DHFLDANGAL KKTEAFIPFS LGKRICLGEG IARAELFLFF 
       460        470        480        490 
TTILQNFSMA SPVAPEDIDL TPQECGVGKI PPTYQIRFLP R

Length:491

Mass (Da):56,278

Last modified:February 1, 1991 - v1

Checksum:ⁱB9799164BE8FBF1D

GO

Isoform 2 (identifier: P20813-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-57: MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLR → MRCMLTNSHPWCGCDWQ
162-321: Missing.

« Hide

        10         20         30         40         50
MRCMLTNSHP WCGCDWQFRE KYGDVFTVHL GPRPVVMLCG VEAIREALVD 
        60         70         80         90        100
KAEAFSGRGK IAMVDPFFRG YGVIFANGNR WKVLRRFSVT TMRDFGMGKR 
       110        120        130        140        150
SVEERIQEEA QCLIEELRKS KERVYREIEQ VIGPHRPPEL HDRAKMPYTE 
       160        170        180        190        200
AVIYEIQRFS DLLPMGVPHI VTQHTSFRGY IIPKDTEVFL ILSTALHDPH 
       210        220        230        240        250
YFEKPDAFNP DHFLDANGAL KKTEAFIPFS LGKRICLGEG IARAELFLFF 
       260        270        280        290 
TTILQNFSMA SPVAPEDIDL TPQECGVGKI PPTYQIRFLP R

Note: No experimental confirmation available.

Show »

Length:291

Mass (Da):33,385

Checksum:ⁱA4B40F24ED632B8D

GO

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

M0QZJ2	M0QZJ2_HUMAN	Cytochrome P450 2B6 Cytochrome P450 2B6	CYP2B6	255	Annotation score:
A0A2R8YFA4	A0A2R8YFA4_HUMAN	Cytochrome P450 2B6 Cytochrome P450 2B6	CYP2B6	194	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	146	I → T in AAF13602 (Ref. 2) Curated		1
Sequence conflictⁱ	238	L → P in AAF13602 (Ref. 2) Curated		1

Polymorphismⁱ

Genetic variations in CYP2B6 are responsible for poor metabolism of efavirenz and, therefore, susceptibility to efavirenz toxicity in the central nervous system [MIMⁱ:614546]. Efavirenz is a non-nucleoside reverse transcriptase inhibitor frequently prescribed with 2 nucleoside reverse transcriptase inhibitors as initial therapy for human immunodeficiency virus (HIV) infection. Up to half of patients treated with efavirenz, experience side effects in the central nervous system, including dizziness, insomnia, impaired concentration, somnolence, and abnormal dreams. Severe depression, aggressive behavior, and paranoid or manic reactions may also occur, depending on efavirenz concentration in the plasma.

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_023563	21	Q → L in allele CYP2B6*10. 1 PublicationCorresponds to variant dbSNP:rs34883432Ensembl.	1
Natural variantⁱVAR_016927	22	R → C in allele CYP2B62 and allele CYP2B610. 6 PublicationsCorresponds to variant dbSNP:rs8192709Ensembl.	1
Natural variantⁱVAR_025206	26	T → S1 PublicationCorresponds to variant dbSNP:rs33973337Ensembl.	1
Natural variantⁱVAR_025207	28	D → G1 PublicationCorresponds to variant dbSNP:rs33980385Ensembl.	1
Natural variantⁱVAR_033819	29	R → P. Corresponds to variant dbSNP:rs34284776Ensembl.	1
Natural variantⁱVAR_025208	29	R → S1 PublicationCorresponds to variant dbSNP:rs33926104Ensembl.	1
Natural variantⁱVAR_023564	46	M → V in allele CYP2B6*11. 1 PublicationCorresponds to variant dbSNP:rs35303484Ensembl.	1
Natural variantⁱVAR_023565	99	G → E in allele CYP2B6*12. 1 PublicationCorresponds to variant dbSNP:rs36060847Ensembl.	1
Natural variantⁱVAR_016948	139	K → E in allele CYP2B68 and allele CYP2B613. 2 PublicationsCorresponds to variant dbSNP:rs12721655Ensembl.	1
Natural variantⁱVAR_023566	140	R → Q in allele CYP2B6*14. 1 PublicationCorresponds to variant dbSNP:rs35773040Ensembl.	1
Natural variantⁱVAR_016924	167	P → A2 PublicationsCorresponds to variant dbSNP:rs3826711Ensembl.	1
Natural variantⁱVAR_016925	172	Q → H in allele CYP2B66, allele CYP2B67, allele CYP2B69 and allele CYP2B613. 8 PublicationsCorresponds to variant dbSNP:rs3745274EnsemblClinVar.	1
Natural variantⁱVAR_016928	259	S → R in allele CYP2B6*3. 2 PublicationsCorresponds to variant dbSNP:rs45482602Ensembl.	1
Natural variantⁱVAR_016926	262	K → R in allele CYP2B64, allele CYP2B66, allele CYP2B67 and allele CYP2B613; slight decrease in activity. 5 PublicationsCorresponds to variant dbSNP:rs2279343EnsemblClinVar.	1
Natural variantⁱVAR_025209	289	N → K1 PublicationCorresponds to variant dbSNP:rs34277950Ensembl.	1
Natural variantⁱVAR_025210	306	T → S1 PublicationCorresponds to variant dbSNP:rs34698757Ensembl.	1
Natural variantⁱVAR_024716	328	I → T2 PublicationsCorresponds to variant dbSNP:rs28399499EnsemblClinVar.	1
Natural variantⁱVAR_023567	391	I → N in allele CYP2B6*15. 1 PublicationCorresponds to variant dbSNP:rs35979566Ensembl.	1
Natural variantⁱVAR_016929	487	R → C in allele CYP2B65 and allele CYP2B67. 6 PublicationsCorresponds to variant dbSNP:rs3211371Ensembl.	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_055571	1 – 57	MELSV…KSFLR → MRCMLTNSHPWCGCDWQ in isoform 2. 1 PublicationAdd BLAST		57
Alternative sequenceⁱVSP_055572	162 – 321	Missing in isoform 2. 1 PublicationAdd BLAST		160

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M29874 mRNA Translation: AAA52144.1 AF182277 mRNA Translation: AAF13602.1 AK301620 mRNA Translation: BAG63105.1 DQ298753 Genomic DNA Translation: ABB84469.1 AC023172 Genomic DNA Translation: AAF32444.1 AC011541 Genomic DNA No translation available. X13494 mRNA No translation available.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS12570.1 [P20813-1]
PIRⁱ	A32969
NCBI Reference Sequences More...RefSeqⁱ	NP_000758.1, NM_000767.4 [P20813-1] XP_011524852.1, XM_011526550.2
UniGeneⁱ	Hs.1360

Genome annotation databases

Ensemblⁱ	ENST00000324071; ENSP00000324648; ENSG00000197408 [P20813-1] ENST00000643956; ENSP00000495579; ENSG00000197408 [P20813-1]
GeneIDⁱ	1555
KEGGⁱ	hsa:1555
UCSC genome browser More...UCSCⁱ	uc002opr.2 human [P20813-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P20813	Cytochrome P450 2B6 (Fragment)		HUMAN		53	UniRef100_P20813
Cytochrome P450 (Fragment)		HUMAN		52
P20813-2	Cytochrome P450 2B6		HUMAN		255	UniRef100_M0QZJ2

Protein	Similar proteins		Species	Score	Length	Source
P20813	Cytochrome P450 2B6 (Fragment)		HUMAN		53	UniRef90_P20813
CYP2B6 isoform 1		PANTR		491
Uncharacterized protein		PANPA		491
Uncharacterized protein		PAPAN		491
Cytochrome P450 family 2 subfamily B member 6		GORGO		491
+33
P20813-2	Cytochrome P450 2B6		HUMAN		255	UniRef90_M0QZJ2
Uncharacterized protein		MACMU		255
CYP2B6 isoform 3		PANTR		255
Uncharacterized protein		PANPA		255
Uncharacterized protein		PAPAN		255
+9

Protein	Similar proteins		Species	Score	Length	Source
P20813	Cytochrome P450 2B5		RABIT		491	UniRef50_P20813
Cytochrome P450 2B6 (Fragment)		HUMAN		53
Uncharacterized protein		RHIRO		491
Uncharacterized protein		MACNE		491
Uncharacterized protein		MANLE		491
+58
P20813-2	Cytochrome P450 2B6		HUMAN		255	UniRef50_M0QZJ2
CYP2B6 isoform 3 (Fragment)		PONAB		255
Cytochrome P450 family 2 subfamily B member 6		GORGO		255
Uncharacterized protein		MACNE		255
Uncharacterized protein		MACMU		255
+11

Cross-referencesⁱ

Web resourcesⁱ

Cytochrome P450 Allele Nomenclature Committee

CYP2B6 alleles

NIEHS-SNPs

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M29874 mRNA Translation: AAA52144.1 AF182277 mRNA Translation: AAF13602.1 AK301620 mRNA Translation: BAG63105.1 DQ298753 Genomic DNA Translation: ABB84469.1 AC023172 Genomic DNA Translation: AAF32444.1 AC011541 Genomic DNA No translation available. X13494 mRNA No translation available.
CCDSⁱ	CCDS12570.1 [P20813-1]
PIRⁱ	A32969
RefSeqⁱ	NP_000758.1, NM_000767.4 [P20813-1] XP_011524852.1, XM_011526550.2
UniGeneⁱ	Hs.1360

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3IBD	X-ray	2.00	A	30-491	[»]
	3QOA	X-ray	2.10	A	27-491	[»]
	3QU8	X-ray	2.80	A/B/C/D/E/F	27-491	[»]
	3UA5	X-ray	2.80	A/B	27-491	[»]
	4I91	X-ray	2.00	A	27-491	[»]
	4RQL	X-ray	2.10	A/B	27-491	[»]
	4RRT	X-ray	2.20	A/B	27-491	[»]
	4ZV8	X-ray	2.24	A	30-491	[»]
	5UAP	X-ray	2.03	A/B	20-491	[»]
	5UDA	X-ray	1.93	A/B	20-491	[»]
	5UEC	X-ray	2.27	A	20-491	[»]
	5UFG	X-ray	1.76	A	20-491	[»]
	5WBG	X-ray	2.99	A/B/C/D/E/F	20-491	[»]
ProteinModelPortalⁱ	P20813
SMRⁱ	P20813
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	107933, 4 interactors
STRINGⁱ	9606.ENSP00000324648

Chemistry databases

BindingDBⁱ	P20813
ChEMBLⁱ	CHEMBL4729
DrugBankⁱ	DB08369 1-(biphenyl-4-ylmethyl)-1H-imidazole DB02974 4-(4-Chlorophenyl)Imidazole DB00321 Amitriptyline DB00381 Amlodipine DB00701 Amprenavir DB01435 Antipyrine DB06413 Armodafinil DB06697 Artemether DB01076 Atorvastatin DB00972 Azelastine DB04975 Banoxantrone DB00865 Benzphetamine DB06770 Benzyl alcohol DB04794 Bifonazole DB00835 Brompheniramine DB01156 Bupropion DB00564 Carbamazepine DB00748 Carbinoxamine DB00439 Cerivastatin DB00169 Cholecalciferol DB00568 Cinnarizine DB00604 Cisapride DB00515 Cisplatin DB00215 Citalopram DB00349 Clobazam DB00636 Clofibrate DB00758 Clopidogrel DB01559 Clotiazepam DB00257 Clotrimazole DB01394 Colchicine DB05219 Crisaborole DB08865 Crizotinib DB04664 Cyclohexyl-pentyl-maltoside DB00531 Cyclophosphamide DB01151 Desipramine DB01234 Dexamethasone DB00514 Dextromethorphan DB00829 Diazepam DB00586 Diclofenac DB01075 Diphenhydramine DB01184 Domperidone DB00997 Doxorubicin DB00625 Efavirenz DB08899 Enzalutamide DB00751 Epinastine DB00199 Erythromycin DB00655 Estrone DB00898 Ethanol DB01466 Ethylmorphine DB04841 Flunarizine DB01544 Flunitrazepam DB00472 Fluoxetine DB01095 Fluvastatin DB00176 Fluvoxamine DB01320 Fosphenytoin DB01159 Halothane DB09054 Idelalisib DB01181 Ifosfamide DB00458 Imipramine DB00762 Irinotecan DB00753 Isoflurane DB01167 Itraconazole DB09570 Ixazomib DB01221 Ketamine DB06738 Ketobemidone DB01026 Ketoconazole DB00281 Lidocaine DB00836 Loperamide DB01601 Lopinavir DB04871 Lorcaserin DB09280 Lumacaftor DB00772 Malathion DB01043 Memantine DB00532 Mephenytoin DB04817 Metamizole DB00333 Methadone DB00763 Methimazole DB01028 Methoxyflurane DB00849 Methylphenobarbital DB06710 Methyltestosterone DB00379 Mexiletine DB06148 Mianserin DB01110 Miconazole DB00683 Midazolam DB00745 Modafinil DB00220 Nelfinavir DB00238 Nevirapine DB00622 Nicardipine DB00184 Nicotine DB01115 Nifedipine DB04868 Nilotinib DB00435 Nitric Oxide DB09074 Olaparib DB01173 Orphenadrine DB04938 Ospemifene DB00715 Paroxetine DB01074 Perhexiline DB04930 Permethrin DB00850 Perphenazine DB00454 Pethidine DB03575 Phencyclidine DB01174 Phenobarbital DB00252 Phenytoin DB06209 Prasugrel DB00794 Primidone DB01069 Promethazine DB00818 Propofol DB01589 Quazepam DB00908 Quinidine DB00481 Raloxifene DB08896 Regorafenib DB01045 Rifampicin DB08864 Rilpivirine DB00503 Ritonavir DB06176 Romidepsin DB00296 Ropivacaine DB00778 Roxithromycin DB01037 Selegiline DB01104 Sertraline DB01236 Sevoflurane DB00641 Simvastatin DB00398 Sorafenib DB06729 Sulfaphenazole DB01138 Sulfinpyrazone DB00675 Tamoxifen DB00231 Temazepam DB00624 Testosterone DB04572 Thiotepa DB00208 Ticlopidine DB00193 Tramadol DB00755 Tretinoin DB00197 Troglitazone DB00313 Valproic Acid DB00285 Venlafaxine DB00661 Verapamil DB09068 Vortioxetine
GuidetoPHARMACOLOGYⁱ	1324
SwissLipidsⁱ	SLP:000001346

PTM databases

iPTMnetⁱ	P20813
PhosphoSitePlusⁱ	P20813

Polymorphism and mutation databases

BioMutaⁱ	CYP2B6
DMDMⁱ	117205

Proteomic databases

EPDⁱ	P20813
PaxDbⁱ	P20813
PeptideAtlasⁱ	P20813
PRIDEⁱ	P20813
ProteomicsDBⁱ	53803

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000324071; ENSP00000324648; ENSG00000197408 [P20813-1] ENST00000643956; ENSP00000495579; ENSG00000197408 [P20813-1]
GeneIDⁱ	1555
KEGGⁱ	hsa:1555
UCSCⁱ	uc002opr.2 human [P20813-1]

Organism-specific databases

CTDⁱ	1555
DisGeNETⁱ	1555
EuPathDBⁱ	HostDB:ENSG00000197408.8
GeneCardsⁱ	CYP2B6
HGNCⁱ	HGNC:2615 CYP2B6
HPAⁱ	CAB033866 HPA048124 HPA062973
MalaCardsⁱ	CYP2B6
MIMⁱ	123930 gene 614546 phenotype
neXtProtⁱ	NX_P20813
OpenTargetsⁱ	ENSG00000197408
Orphanetⁱ	240869 Efavirenz toxicity
PharmGKBⁱ	PA123
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0156 Eukaryota COG2124 LUCA
GeneTreeⁱ	ENSGT00880000137861
HOGENOMⁱ	HOG000036992
HOVERGENⁱ	HBG015789
InParanoidⁱ	P20813
KOⁱ	K17709
OMAⁱ	HTSFRGY
OrthoDBⁱ	EOG091G0BT8
PhylomeDBⁱ	P20813
TreeFamⁱ	TF352043

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS09587-MONOMER
BRENDAⁱ	1.14.14.1 2681
Reactomeⁱ	R-HSA-211935 Fatty acids R-HSA-211981 Xenobiotics R-HSA-211999 CYP2E1 reactions
SABIO-RKⁱ	P20813
SIGNORⁱ	P20813

Miscellaneous databases

EvolutionaryTraceⁱ	P20813
GeneWikiⁱ	CYP2B6
GenomeRNAiⁱ	1555
Protein Ontology More...PROⁱ	PR:P20813
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000197408 Expressed in 75 organ(s), highest expression level in right lobe of liver
CleanExⁱ	HS_CYP2B6
ExpressionAtlasⁱ	P20813 baseline and differential
Genevisibleⁱ	P20813 HS

Family and domain databases

Gene3Dⁱ	1.10.630.10, 1 hit
InterProⁱ	View protein in InterPro IPR001128 Cyt_P450 IPR017972 Cyt_P450_CS IPR002401 Cyt_P450_E_grp-I IPR008068 Cyt_P450_E_grp-I_CYP2B-like IPR036396 Cyt_P450_sf
Pfamⁱ	View protein in Pfam PF00067 p450, 1 hit
PRINTSⁱ	PR00463 EP450I PR01685 EP450ICYP2B PR00385 P450
SUPFAMⁱ	SSF48264 SSF48264, 1 hit
PROSITEⁱ	View protein in PROSITE PS00086 CYTOCHROME_P450, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CP2B6_HUMAN
Accessionⁱ	P20813Primary (citable) accession number: P20813 Secondary accession number(s): B4DWP3, Q2V565, Q9UK46
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1991
	Last sequence update:	February 1, 1991
	Last modified:	October 10, 2018
	This is version 197 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

PDB cross-references
Index of Protein Data Bank (PDB) cross-references
SIMILARITY comments
Index of protein domains and families
Human chromosome 19
Human chromosome 19: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P20813 (CP2B6_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cytochrome P450 2B6

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Chemistry databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endoplasmic reticulum

Endoplasmic reticulum

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Kineticsⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ