Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-L

Gene

ITGAL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin alpha-L/beta-2 is also a receptor for F11R (PubMed:11812992, PubMed:15528364). Involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Contributes to natural killer cell cytotoxicity (PubMed:15356110). Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils (PubMed:11812992). Required for generation of common lymphoid progenitor cells in bone marrow, indicating a role in lymphopoiesis (By similarity). Integrin alpha-L/beta-2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages (PubMed:23775590).By similarity4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi468 – 476Sequence analysis9
Calcium bindingi530 – 538Sequence analysis9
Calcium bindingi590 – 598Sequence analysis9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIntegrin, Receptor
Biological processCell adhesion, Phagocytosis
LigandCalcium, Magnesium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-216083 Integrin cell surface interactions
R-HSA-6798695 Neutrophil degranulation
R-HSA-8949275 RUNX3 Regulates Immune Response and Cell Migration

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P20701

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P20701

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Integrin alpha-L
Alternative name(s):
CD11 antigen-like family member A
Leukocyte adhesion glycoprotein LFA-1 alpha chain
Short name:
LFA-1A
Leukocyte function-associated molecule 1 alpha chain
CD_antigen: CD11a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ITGAL
Synonyms:CD11A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000005844.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6148 ITGAL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
153370 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P20701

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini26 – 1090ExtracellularSequence analysisAdd BLAST1065
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1091 – 1111HelicalSequence analysisAdd BLAST21
Topological domaini1112 – 1170CytoplasmicSequence analysisAdd BLAST59

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1165S → A: Abolishes phosphorylation and MEM-83-activated T-cell adhesion to ICAM1. Abolishes integrin alpha-L/beta-2 activation by CXCL12 and TERF2IP/RAP1. Does not affect heterodimerization of cell surface expression. Does not affect TCR- or phorbol ester-activated T-cell adhesion to ICAM1. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
3683

Open Targets

More...
OpenTargetsi
ENSG00000005844

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29948

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1803

Drug and drug target database

More...
DrugBanki
DB02177 1-Acetyl-4-(4-{4-[(2-Ethoxyphenyl)Thio]-3-Nitrophenyl}Pyridin-2-Yl)Piperazine
DB00098 Anti-thymocyte Globulin (Rabbit)
DB00095 Efalizumab
DB03932 LFA703
DB11611 Lifitegrast
DB00227 Lovastatin

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2451

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ITGAL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
88911345

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001629226 – 1170Integrin alpha-LAdd BLAST1145

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi65N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi73 ↔ 80By similarity
Glycosylationi89N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi111 ↔ 129By similarity
Glycosylationi188N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi649N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi653 ↔ 707By similarity
Glycosylationi670N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi726N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi730N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi771 ↔ 777By similarity
Disulfide bondi845 ↔ 861By similarity
Glycosylationi862N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi885N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi897N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi998 ↔ 1013By similarity
Disulfide bondi1021 ↔ 1052By similarity
Glycosylationi1060N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1071N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1165Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

In resting T-cells, up to 40% of surface ITGAL is constitutively phosphorylated. Phosphorylation causes conformational changes needed for ligand binding and is necessary for activation by some physiological agents.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P20701

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P20701

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P20701

PeptideAtlas

More...
PeptideAtlasi
P20701

PRoteomics IDEntifications database

More...
PRIDEi
P20701

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53774
53775 [P20701-2]
53776 [P20701-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1410

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P20701

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P20701

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Leukocytes.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000005844 Expressed in 210 organ(s), highest expression level in leukocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_ITGAL

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P20701 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P20701 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB025011

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit (PubMed:12526797). Alpha-L associates with beta-2 (PubMed:12526797). Interacts with THBD (PubMed:27055590).2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109889, 6 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1825 Integrin alphaL-beta2 complex

Database of interacting proteins

More...
DIPi
DIP-623N

Protein interaction database and analysis system

More...
IntActi
P20701, 7 interactors

Molecular INTeraction database

More...
MINTi
P20701

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000349252

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P20701

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11170
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CQPX-ray2.60A/B153-334[»]
1DGQNMR-A152-336[»]
1IJ4model-L153-333[»]
1LFAX-ray1.80A/B150-336[»]
1MJNX-ray1.30A153-331[»]
1MQ8X-ray3.30B/D155-331[»]
1MQ9X-ray2.00A153-331[»]
1MQAX-ray2.50A153-331[»]
1RD4X-ray2.40A/B/C/D150-336[»]
1T0PX-ray1.66A153-326[»]
1XDDX-ray2.20A/B152-336[»]
1XDGX-ray2.10A/B152-336[»]
1XUOX-ray1.80A/B152-336[»]
1ZONX-ray2.00A150-336[»]
1ZOOX-ray3.00A/B150-336[»]
1ZOPX-ray2.00A/B150-336[»]
2ICAX-ray1.56A154-332[»]
2K8ONMR-A1113-1170[»]
2M3ENMR-A1082-1128[»]
2O7NX-ray1.75A154-332[»]
3BN3X-ray2.10A154-332[»]
3BQMX-ray1.95B/C153-334[»]
3BQNX-ray1.80B/C153-334[»]
3E2MX-ray2.00A/B152-334[»]
3EOAX-ray2.80I/J153-333[»]
3EOBX-ray3.60I/J153-333[»]
3F74X-ray1.70A/B/C153-332[»]
3F78X-ray1.60A/B/C153-332[»]
3HI6X-ray2.30A/B153-332[»]
3M6FX-ray1.85A154-332[»]
3TCXX-ray3.60B/D/F/H/J/L/N/P/R/T/V/X/Z/b154-332[»]
4IXDX-ray1.80A152-336[»]
5E6RX-ray2.90A26-770[»]
5E6SX-ray2.15A/C/E26-770[»]
5E6UX-ray2.50A26-770[»]
6BXBX-ray2.39A/B153-331[»]
6BXFX-ray3.20A/B153-331[»]
6BXJX-ray2.09A153-331[»]
6CKBX-ray2.80A/B153-331[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P20701

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P20701

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P20701

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati31 – 82FG-GAP 1PROSITE-ProRule annotationAdd BLAST52
Repeati83 – 141FG-GAP 2PROSITE-ProRule annotationAdd BLAST59
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini156 – 327VWFAPROSITE-ProRule annotationAdd BLAST172
Repeati338 – 389FG-GAP 3PROSITE-ProRule annotationAdd BLAST52
Repeati390 – 445FG-GAP 4PROSITE-ProRule annotationAdd BLAST56
Repeati446 – 506FG-GAP 5PROSITE-ProRule annotationAdd BLAST61
Repeati507 – 563FG-GAP 6PROSITE-ProRule annotationAdd BLAST57
Repeati567 – 627FG-GAP 7PROSITE-ProRule annotationAdd BLAST61

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1115 – 1119GFFKR motif5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The integrin I-domain (insert) is a VWFA domain (PubMed:2537322). Integrins with I-domains do not undergo protease cleavage. The I-domain is necessary and sufficient for interaction with ICAM1 and F11R (PubMed:15528364).2 Publications

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3637 Eukaryota
ENOG410XPVZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161495

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113114

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006188

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P20701

KEGG Orthology (KO)

More...
KOi
K05718

Identification of Orthologs from Complete Genome Data

More...
OMAi
PHSQIPV

Database of Orthologous Groups

More...
OrthoDBi
73876at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P20701

TreeFam database of animal gene trees

More...
TreeFami
TF105391

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.130, 1 hit
3.40.50.410, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
IPR002035 VWF_A
IPR036465 vWFA_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01839 FG-GAP, 1 hit
PF00357 Integrin_alpha, 1 hit
PF08441 Integrin_alpha2, 1 hit
PF00092 VWA, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01185 INTEGRINA

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00191 Int_alpha, 5 hits
SM00327 VWA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53300 SSF53300, 1 hit
SSF69179 SSF69179, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit
PS50234 VWFA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P20701-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDSCITVMA MALLSGFFFF APASSYNLDV RGARSFSPPR AGRHFGYRVL
60 70 80 90 100
QVGNGVIVGA PGEGNSTGSL YQCQSGTGHC LPVTLRGSNY TSKYLGMTLA
110 120 130 140 150
TDPTDGSILA CDPGLSRTCD QNTYLSGLCY LFRQNLQGPM LQGRPGFQEC
160 170 180 190 200
IKGNVDLVFL FDGSMSLQPD EFQKILDFMK DVMKKLSNTS YQFAAVQFST
210 220 230 240 250
SYKTEFDFSD YVKRKDPDAL LKHVKHMLLL TNTFGAINYV ATEVFREELG
260 270 280 290 300
ARPDATKVLI IITDGEATDS GNIDAAKDII RYIIGIGKHF QTKESQETLH
310 320 330 340 350
KFASKPASEF VKILDTFEKL KDLFTELQKK IYVIEGTSKQ DLTSFNMELS
360 370 380 390 400
SSGISADLSR GHAVVGAVGA KDWAGGFLDL KADLQDDTFI GNEPLTPEVR
410 420 430 440 450
AGYLGYTVTW LPSRQKTSLL ASGAPRYQHM GRVLLFQEPQ GGGHWSQVQT
460 470 480 490 500
IHGTQIGSYF GGELCGVDVD QDGETELLLI GAPLFYGEQR GGRVFIYQRR
510 520 530 540 550
QLGFEEVSEL QGDPGYPLGR FGEAITALTD INGDGLVDVA VGAPLEEQGA
560 570 580 590 600
VYIFNGRHGG LSPQPSQRIE GTQVLSGIQW FGRSIHGVKD LEGDGLADVA
610 620 630 640 650
VGAESQMIVL SSRPVVDMVT LMSFSPAEIP VHEVECSYST SNKMKEGVNI
660 670 680 690 700
TICFQIKSLI PQFQGRLVAN LTYTLQLDGH RTRRRGLFPG GRHELRRNIA
710 720 730 740 750
VTTSMSCTDF SFHFPVCVQD LISPINVSLN FSLWEEEGTP RDQRAQGKDI
760 770 780 790 800
PPILRPSLHS ETWEIPFEKN CGEDKKCEAN LRVSFSPARS RALRLTAFAS
810 820 830 840 850
LSVELSLSNL EEDAYWVQLD LHFPPGLSFR KVEMLKPHSQ IPVSCEELPE
860 870 880 890 900
ESRLLSRALS CNVSSPIFKA GHSVALQMMF NTLVNSSWGD SVELHANVTC
910 920 930 940 950
NNEDSDLLED NSATTIIPIL YPINILIQDQ EDSTLYVSFT PKGPKIHQVK
960 970 980 990 1000
HMYQVRIQPS IHDHNIPTLE AVVGVPQPPS EGPITHQWSV QMEPPVPCHY
1010 1020 1030 1040 1050
EDLERLPDAA EPCLPGALFR CPVVFRQEIL VQVIGTLELV GEIEASSMFS
1060 1070 1080 1090 1100
LCSSLSISFN SSKHFHLYGS NASLAQVVMK VDVVYEKQML YLYVLSGIGG
1110 1120 1130 1140 1150
LLLLLLIFIV LYKVGFFKRN LKEKMEAGRG VPNGIPAEDS EQLASGQEAG
1160 1170
DPGCLKPLHE KDSESGGGKD
Length:1,170
Mass (Da):128,770
Last modified:February 7, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i22A7AF92EF286876
GO
Isoform 2 (identifier: P20701-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     954-954: Q → QGVHGLVEMQTSKQILCRPAGDAEHTVGAQEGELPCPWGVSEAFRDNIRAGPCR

Note: No experimental confirmation available.
Show »
Length:1,223
Mass (Da):134,427
Checksum:iAF2302FAC076924D
GO
Isoform 3 (identifier: P20701-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-192: Missing.
     746-746: Missing.

Show »
Length:1,086
Mass (Da):119,224
Checksum:iF6FF2546E8C632F9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DQ77B4DQ77_HUMAN
cDNA FLJ56671, highly similar to In...
ITGAL
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4E021B4E021_HUMAN
cDNA FLJ57691, highly similar to In...
ITGAL
404Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSV1H3BSV1_HUMAN
Integrin alpha-L
ITGAL
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L468I3L468_HUMAN
Integrin alpha-L
ITGAL
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BUT3H3BUT3_HUMAN
Integrin alpha-L
ITGAL
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNL5H3BNL5_HUMAN
Integrin alpha-L
ITGAL
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BS37H3BS37_HUMAN
Integrin alpha-L
ITGAL
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1D1I3L1D1_HUMAN
Integrin alpha-L
ITGAL
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti660I → Y in CAA68747 (PubMed:2537322).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_025235144R → H1 PublicationCorresponds to variant dbSNP:rs34166708Ensembl.1
Natural variantiVAR_025236214R → W3 PublicationsCorresponds to variant dbSNP:rs1064524Ensembl.1
Natural variantiVAR_025237746Q → K1 PublicationCorresponds to variant dbSNP:rs34838942Ensembl.1
Natural variantiVAR_025238791R → T1 PublicationCorresponds to variant dbSNP:rs2230433Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042842110 – 192Missing in isoform 3. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_042843746Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_002738954Q → QGVHGLVEMQTSKQILCRPA GDAEHTVGAQEGELPCPWGV SEAFRDNIRAGPCR in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y00796 mRNA Translation: CAA68747.1
DQ131904 Genomic DNA Translation: AAZ38713.1
AC002310 Genomic DNA Translation: AAC31672.1
AC116348 Genomic DNA No translation available.
CH471192 Genomic DNA Translation: EAW52243.1
BC008777 mRNA Translation: AAH08777.1
M95609 Genomic DNA Translation: AAA16474.2
Z22804 Genomic DNA Translation: CAA80461.1
M87662 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32433.1 [P20701-1]
CCDS45461.1 [P20701-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
S03308

NCBI Reference Sequences

More...
RefSeqi
NP_001107852.1, NM_001114380.1 [P20701-3]
NP_002200.2, NM_002209.2 [P20701-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.174103

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356798; ENSP00000349252; ENSG00000005844 [P20701-1]
ENST00000358164; ENSP00000350886; ENSG00000005844 [P20701-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3683

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3683

UCSC genome browser

More...
UCSCi
uc002dyi.5 human [P20701-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y00796 mRNA Translation: CAA68747.1
DQ131904 Genomic DNA Translation: AAZ38713.1
AC002310 Genomic DNA Translation: AAC31672.1
AC116348 Genomic DNA No translation available.
CH471192 Genomic DNA Translation: EAW52243.1
BC008777 mRNA Translation: AAH08777.1
M95609 Genomic DNA Translation: AAA16474.2
Z22804 Genomic DNA Translation: CAA80461.1
M87662 Genomic DNA No translation available.
CCDSiCCDS32433.1 [P20701-1]
CCDS45461.1 [P20701-3]
PIRiS03308
RefSeqiNP_001107852.1, NM_001114380.1 [P20701-3]
NP_002200.2, NM_002209.2 [P20701-1]
UniGeneiHs.174103

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CQPX-ray2.60A/B153-334[»]
1DGQNMR-A152-336[»]
1IJ4model-L153-333[»]
1LFAX-ray1.80A/B150-336[»]
1MJNX-ray1.30A153-331[»]
1MQ8X-ray3.30B/D155-331[»]
1MQ9X-ray2.00A153-331[»]
1MQAX-ray2.50A153-331[»]
1RD4X-ray2.40A/B/C/D150-336[»]
1T0PX-ray1.66A153-326[»]
1XDDX-ray2.20A/B152-336[»]
1XDGX-ray2.10A/B152-336[»]
1XUOX-ray1.80A/B152-336[»]
1ZONX-ray2.00A150-336[»]
1ZOOX-ray3.00A/B150-336[»]
1ZOPX-ray2.00A/B150-336[»]
2ICAX-ray1.56A154-332[»]
2K8ONMR-A1113-1170[»]
2M3ENMR-A1082-1128[»]
2O7NX-ray1.75A154-332[»]
3BN3X-ray2.10A154-332[»]
3BQMX-ray1.95B/C153-334[»]
3BQNX-ray1.80B/C153-334[»]
3E2MX-ray2.00A/B152-334[»]
3EOAX-ray2.80I/J153-333[»]
3EOBX-ray3.60I/J153-333[»]
3F74X-ray1.70A/B/C153-332[»]
3F78X-ray1.60A/B/C153-332[»]
3HI6X-ray2.30A/B153-332[»]
3M6FX-ray1.85A154-332[»]
3TCXX-ray3.60B/D/F/H/J/L/N/P/R/T/V/X/Z/b154-332[»]
4IXDX-ray1.80A152-336[»]
5E6RX-ray2.90A26-770[»]
5E6SX-ray2.15A/C/E26-770[»]
5E6UX-ray2.50A26-770[»]
6BXBX-ray2.39A/B153-331[»]
6BXFX-ray3.20A/B153-331[»]
6BXJX-ray2.09A153-331[»]
6CKBX-ray2.80A/B153-331[»]
ProteinModelPortaliP20701
SMRiP20701
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109889, 6 interactors
ComplexPortaliCPX-1825 Integrin alphaL-beta2 complex
DIPiDIP-623N
IntActiP20701, 7 interactors
MINTiP20701
STRINGi9606.ENSP00000349252

Chemistry databases

BindingDBiP20701
ChEMBLiCHEMBL1803
DrugBankiDB02177 1-Acetyl-4-(4-{4-[(2-Ethoxyphenyl)Thio]-3-Nitrophenyl}Pyridin-2-Yl)Piperazine
DB00098 Anti-thymocyte Globulin (Rabbit)
DB00095 Efalizumab
DB03932 LFA703
DB11611 Lifitegrast
DB00227 Lovastatin
GuidetoPHARMACOLOGYi2451

PTM databases

GlyConnecti1410
iPTMnetiP20701
PhosphoSitePlusiP20701

Polymorphism and mutation databases

BioMutaiITGAL
DMDMi88911345

Proteomic databases

jPOSTiP20701
MaxQBiP20701
PaxDbiP20701
PeptideAtlasiP20701
PRIDEiP20701
ProteomicsDBi53774
53775 [P20701-2]
53776 [P20701-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3683
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356798; ENSP00000349252; ENSG00000005844 [P20701-1]
ENST00000358164; ENSP00000350886; ENSG00000005844 [P20701-3]
GeneIDi3683
KEGGihsa:3683
UCSCiuc002dyi.5 human [P20701-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3683
DisGeNETi3683
EuPathDBiHostDB:ENSG00000005844.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ITGAL

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0012960
HIX0026987
HGNCiHGNC:6148 ITGAL
HPAiCAB025011
MIMi153370 gene
neXtProtiNX_P20701
OpenTargetsiENSG00000005844
PharmGKBiPA29948

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3637 Eukaryota
ENOG410XPVZ LUCA
GeneTreeiENSGT00940000161495
HOGENOMiHOG000113114
HOVERGENiHBG006188
InParanoidiP20701
KOiK05718
OMAiPHSQIPV
OrthoDBi73876at2759
PhylomeDBiP20701
TreeFamiTF105391

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-216083 Integrin cell surface interactions
R-HSA-6798695 Neutrophil degranulation
R-HSA-8949275 RUNX3 Regulates Immune Response and Cell Migration
SignaLinkiP20701
SIGNORiP20701

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ITGAL human
EvolutionaryTraceiP20701

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CD11a

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3683

Protein Ontology

More...
PROi
PR:P20701

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000005844 Expressed in 210 organ(s), highest expression level in leukocyte
CleanExiHS_ITGAL
ExpressionAtlasiP20701 baseline and differential
GenevisibleiP20701 HS

Family and domain databases

Gene3Di2.130.10.130, 1 hit
3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 1 hit
PF00357 Integrin_alpha, 1 hit
PF08441 Integrin_alpha2, 1 hit
PF00092 VWA, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
SSF69179 SSF69179, 2 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit
PS50234 VWFA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiITAL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P20701
Secondary accession number(s): O43746
, Q45H73, Q96HB1, Q9UBC8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 7, 2006
Last modified: January 16, 2019
This is version 205 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again