Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-L

Gene

ITGAL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin alpha-L/beta-2 is also a receptor for F11R (PubMed:11812992, PubMed:15528364). Involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Contributes to natural killer cell cytotoxicity (PubMed:15356110). Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils (PubMed:11812992). Required for generation of common lymphoid progenitor cells in bone marrow, indicating a role in lymphopoiesis (By similarity). Integrin alpha-L/beta-2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages (PubMed:23775590).By similarity4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi468 – 476Sequence analysis9
Calcium bindingi530 – 538Sequence analysis9
Calcium bindingi590 – 598Sequence analysis9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionIntegrin, Receptor
Biological processCell adhesion, Phagocytosis
LigandCalcium, Magnesium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-216083 Integrin cell surface interactions
R-HSA-6798695 Neutrophil degranulation
R-HSA-8949275 RUNX3 Regulates Immune Response and Cell Migration
SignaLinkiP20701
SIGNORiP20701

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-L
Alternative name(s):
CD11 antigen-like family member A
Leukocyte adhesion glycoprotein LFA-1 alpha chain
Short name:
LFA-1A
Leukocyte function-associated molecule 1 alpha chain
CD_antigen: CD11a
Gene namesi
Name:ITGAL
Synonyms:CD11A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000005844.17
HGNCiHGNC:6148 ITGAL
MIMi153370 gene
neXtProtiNX_P20701

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 1090ExtracellularSequence analysisAdd BLAST1065
Transmembranei1091 – 1111HelicalSequence analysisAdd BLAST21
Topological domaini1112 – 1170CytoplasmicSequence analysisAdd BLAST59

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1165S → A: Abolishes phosphorylation and MEM-83-activated T-cell adhesion to ICAM1. Abolishes integrin alpha-L/beta-2 activation by CXCL12 and TERF2IP/RAP1. Does not affect heterodimerization of cell surface expression. Does not affect TCR- or phorbol ester-activated T-cell adhesion to ICAM1. 1 Publication1

Organism-specific databases

DisGeNETi3683
OpenTargetsiENSG00000005844
PharmGKBiPA29948

Chemistry databases

ChEMBLiCHEMBL1803
DrugBankiDB02177 1-Acetyl-4-(4-{4-[(2-Ethoxyphenyl)Thio]-3-Nitrophenyl}Pyridin-2-Yl)Piperazine
DB00098 Anti-thymocyte Globulin (Rabbit)
DB00095 Efalizumab
DB03932 LFA703
DB11611 Lifitegrast
DB00227 Lovastatin
GuidetoPHARMACOLOGYi2451

Polymorphism and mutation databases

BioMutaiITGAL
DMDMi88911345

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Add BLAST25
ChainiPRO_000001629226 – 1170Integrin alpha-LAdd BLAST1145

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi65N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi73 ↔ 80By similarity
Glycosylationi89N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi111 ↔ 129By similarity
Glycosylationi188N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi649N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi653 ↔ 707By similarity
Glycosylationi670N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi726N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi730N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi771 ↔ 777By similarity
Disulfide bondi845 ↔ 861By similarity
Glycosylationi862N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi885N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi897N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi998 ↔ 1013By similarity
Disulfide bondi1021 ↔ 1052By similarity
Glycosylationi1060N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1071N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei1165Phosphoserine1 Publication1

Post-translational modificationi

In resting T-cells, up to 40% of surface ITGAL is constitutively phosphorylated. Phosphorylation causes conformational changes needed for ligand binding and is necessary for activation by some physiological agents.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP20701
PaxDbiP20701
PeptideAtlasiP20701
PRIDEiP20701
ProteomicsDBi53774
53775 [P20701-2]
53776 [P20701-3]

PTM databases

GlyConnecti1410
iPTMnetiP20701
PhosphoSitePlusiP20701

Expressioni

Tissue specificityi

Leukocytes.2 Publications

Gene expression databases

BgeeiENSG00000005844 Expressed in 210 organ(s), highest expression level in leukocyte
CleanExiHS_ITGAL
ExpressionAtlasiP20701 baseline and differential
GenevisibleiP20701 HS

Organism-specific databases

HPAiCAB025011

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit (PubMed:12526797). Alpha-L associates with beta-2 (PubMed:12526797). Interacts with THBD (PubMed:27055590).2 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109889, 6 interactors
ComplexPortaliCPX-1825 Integrin alphaL-beta2 complex
DIPiDIP-623N
IntActiP20701, 7 interactors
MINTiP20701
STRINGi9606.ENSP00000349252

Chemistry databases

BindingDBiP20701

Structurei

Secondary structure

11170
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP20701
SMRiP20701
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP20701

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati31 – 82FG-GAP 1PROSITE-ProRule annotationAdd BLAST52
Repeati83 – 141FG-GAP 2PROSITE-ProRule annotationAdd BLAST59
Domaini156 – 327VWFAPROSITE-ProRule annotationAdd BLAST172
Repeati338 – 389FG-GAP 3PROSITE-ProRule annotationAdd BLAST52
Repeati390 – 445FG-GAP 4PROSITE-ProRule annotationAdd BLAST56
Repeati446 – 506FG-GAP 5PROSITE-ProRule annotationAdd BLAST61
Repeati507 – 563FG-GAP 6PROSITE-ProRule annotationAdd BLAST57
Repeati567 – 627FG-GAP 7PROSITE-ProRule annotationAdd BLAST61

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1115 – 1119GFFKR motif5

Domaini

The integrin I-domain (insert) is a VWFA domain (PubMed:2537322). Integrins with I-domains do not undergo protease cleavage. The I-domain is necessary and sufficient for interaction with ICAM1 and F11R (PubMed:15528364).2 Publications

Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3637 Eukaryota
ENOG410XPVZ LUCA
GeneTreeiENSGT00930000150854
HOGENOMiHOG000113114
HOVERGENiHBG006188
InParanoidiP20701
KOiK05718
OMAiPHSQIPV
OrthoDBiEOG091G03DW
PhylomeDBiP20701
TreeFamiTF105391

Family and domain databases

Gene3Di2.130.10.130, 1 hit
3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 1 hit
PF00357 Integrin_alpha, 1 hit
PF08441 Integrin_alpha2, 1 hit
PF00092 VWA, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
SSF69179 SSF69179, 2 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit
PS50234 VWFA, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P20701-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDSCITVMA MALLSGFFFF APASSYNLDV RGARSFSPPR AGRHFGYRVL
60 70 80 90 100
QVGNGVIVGA PGEGNSTGSL YQCQSGTGHC LPVTLRGSNY TSKYLGMTLA
110 120 130 140 150
TDPTDGSILA CDPGLSRTCD QNTYLSGLCY LFRQNLQGPM LQGRPGFQEC
160 170 180 190 200
IKGNVDLVFL FDGSMSLQPD EFQKILDFMK DVMKKLSNTS YQFAAVQFST
210 220 230 240 250
SYKTEFDFSD YVKRKDPDAL LKHVKHMLLL TNTFGAINYV ATEVFREELG
260 270 280 290 300
ARPDATKVLI IITDGEATDS GNIDAAKDII RYIIGIGKHF QTKESQETLH
310 320 330 340 350
KFASKPASEF VKILDTFEKL KDLFTELQKK IYVIEGTSKQ DLTSFNMELS
360 370 380 390 400
SSGISADLSR GHAVVGAVGA KDWAGGFLDL KADLQDDTFI GNEPLTPEVR
410 420 430 440 450
AGYLGYTVTW LPSRQKTSLL ASGAPRYQHM GRVLLFQEPQ GGGHWSQVQT
460 470 480 490 500
IHGTQIGSYF GGELCGVDVD QDGETELLLI GAPLFYGEQR GGRVFIYQRR
510 520 530 540 550
QLGFEEVSEL QGDPGYPLGR FGEAITALTD INGDGLVDVA VGAPLEEQGA
560 570 580 590 600
VYIFNGRHGG LSPQPSQRIE GTQVLSGIQW FGRSIHGVKD LEGDGLADVA
610 620 630 640 650
VGAESQMIVL SSRPVVDMVT LMSFSPAEIP VHEVECSYST SNKMKEGVNI
660 670 680 690 700
TICFQIKSLI PQFQGRLVAN LTYTLQLDGH RTRRRGLFPG GRHELRRNIA
710 720 730 740 750
VTTSMSCTDF SFHFPVCVQD LISPINVSLN FSLWEEEGTP RDQRAQGKDI
760 770 780 790 800
PPILRPSLHS ETWEIPFEKN CGEDKKCEAN LRVSFSPARS RALRLTAFAS
810 820 830 840 850
LSVELSLSNL EEDAYWVQLD LHFPPGLSFR KVEMLKPHSQ IPVSCEELPE
860 870 880 890 900
ESRLLSRALS CNVSSPIFKA GHSVALQMMF NTLVNSSWGD SVELHANVTC
910 920 930 940 950
NNEDSDLLED NSATTIIPIL YPINILIQDQ EDSTLYVSFT PKGPKIHQVK
960 970 980 990 1000
HMYQVRIQPS IHDHNIPTLE AVVGVPQPPS EGPITHQWSV QMEPPVPCHY
1010 1020 1030 1040 1050
EDLERLPDAA EPCLPGALFR CPVVFRQEIL VQVIGTLELV GEIEASSMFS
1060 1070 1080 1090 1100
LCSSLSISFN SSKHFHLYGS NASLAQVVMK VDVVYEKQML YLYVLSGIGG
1110 1120 1130 1140 1150
LLLLLLIFIV LYKVGFFKRN LKEKMEAGRG VPNGIPAEDS EQLASGQEAG
1160 1170
DPGCLKPLHE KDSESGGGKD
Length:1,170
Mass (Da):128,770
Last modified:February 7, 2006 - v3
Checksum:i22A7AF92EF286876
GO
Isoform 2 (identifier: P20701-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     954-954: Q → QGVHGLVEMQTSKQILCRPAGDAEHTVGAQEGELPCPWGVSEAFRDNIRAGPCR

Note: No experimental confirmation available.
Show »
Length:1,223
Mass (Da):134,427
Checksum:iAF2302FAC076924D
GO
Isoform 3 (identifier: P20701-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-192: Missing.
     746-746: Missing.

Show »
Length:1,086
Mass (Da):119,224
Checksum:iF6FF2546E8C632F9
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DQ77B4DQ77_HUMAN
cDNA FLJ56671, highly similar to In...
ITGAL
162Annotation score:
B4E021B4E021_HUMAN
cDNA FLJ57691, highly similar to In...
ITGAL
404Annotation score:
H3BSV1H3BSV1_HUMAN
Integrin alpha-L
ITGAL
203Annotation score:
I3L468I3L468_HUMAN
Integrin alpha-L
ITGAL
41Annotation score:
H3BUT3H3BUT3_HUMAN
Integrin alpha-L
ITGAL
109Annotation score:
H3BS37H3BS37_HUMAN
Integrin alpha-L
ITGAL
90Annotation score:
H3BNL5H3BNL5_HUMAN
Integrin alpha-L
ITGAL
55Annotation score:
I3L1D1I3L1D1_HUMAN
Integrin alpha-L
ITGAL
38Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti660I → Y in CAA68747 (PubMed:2537322).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025235144R → H1 PublicationCorresponds to variant dbSNP:rs34166708Ensembl.1
Natural variantiVAR_025236214R → W3 PublicationsCorresponds to variant dbSNP:rs1064524Ensembl.1
Natural variantiVAR_025237746Q → K1 PublicationCorresponds to variant dbSNP:rs34838942Ensembl.1
Natural variantiVAR_025238791R → T1 PublicationCorresponds to variant dbSNP:rs2230433Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042842110 – 192Missing in isoform 3. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_042843746Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_002738954Q → QGVHGLVEMQTSKQILCRPA GDAEHTVGAQEGELPCPWGV SEAFRDNIRAGPCR in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y00796 mRNA Translation: CAA68747.1
DQ131904 Genomic DNA Translation: AAZ38713.1
AC002310 Genomic DNA Translation: AAC31672.1
AC116348 Genomic DNA No translation available.
CH471192 Genomic DNA Translation: EAW52243.1
BC008777 mRNA Translation: AAH08777.1
M95609 Genomic DNA Translation: AAA16474.2
Z22804 Genomic DNA Translation: CAA80461.1
M87662 Genomic DNA No translation available.
CCDSiCCDS32433.1 [P20701-1]
CCDS45461.1 [P20701-3]
PIRiS03308
RefSeqiNP_001107852.1, NM_001114380.1 [P20701-3]
NP_002200.2, NM_002209.2 [P20701-1]
UniGeneiHs.174103

Genome annotation databases

EnsembliENST00000356798; ENSP00000349252; ENSG00000005844 [P20701-1]
ENST00000358164; ENSP00000350886; ENSG00000005844 [P20701-3]
GeneIDi3683
KEGGihsa:3683
UCSCiuc002dyi.5 human [P20701-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y00796 mRNA Translation: CAA68747.1
DQ131904 Genomic DNA Translation: AAZ38713.1
AC002310 Genomic DNA Translation: AAC31672.1
AC116348 Genomic DNA No translation available.
CH471192 Genomic DNA Translation: EAW52243.1
BC008777 mRNA Translation: AAH08777.1
M95609 Genomic DNA Translation: AAA16474.2
Z22804 Genomic DNA Translation: CAA80461.1
M87662 Genomic DNA No translation available.
CCDSiCCDS32433.1 [P20701-1]
CCDS45461.1 [P20701-3]
PIRiS03308
RefSeqiNP_001107852.1, NM_001114380.1 [P20701-3]
NP_002200.2, NM_002209.2 [P20701-1]
UniGeneiHs.174103

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CQPX-ray2.60A/B153-334[»]
1DGQNMR-A152-336[»]
1IJ4model-L153-333[»]
1LFAX-ray1.80A/B150-336[»]
1MJNX-ray1.30A153-331[»]
1MQ8X-ray3.30B/D155-331[»]
1MQ9X-ray2.00A153-331[»]
1MQAX-ray2.50A153-331[»]
1RD4X-ray2.40A/B/C/D150-336[»]
1T0PX-ray1.66A153-326[»]
1XDDX-ray2.20A/B152-336[»]
1XDGX-ray2.10A/B152-336[»]
1XUOX-ray1.80A/B152-336[»]
1ZONX-ray2.00A150-336[»]
1ZOOX-ray3.00A/B150-336[»]
1ZOPX-ray2.00A/B150-336[»]
2ICAX-ray1.56A154-332[»]
2K8ONMR-A1113-1170[»]
2M3ENMR-A1082-1128[»]
2O7NX-ray1.75A154-332[»]
3BN3X-ray2.10A154-332[»]
3BQMX-ray1.95B/C153-334[»]
3BQNX-ray1.80B/C153-334[»]
3E2MX-ray2.00A/B152-334[»]
3EOAX-ray2.80I/J153-333[»]
3EOBX-ray3.60I/J153-333[»]
3F74X-ray1.70A/B/C153-332[»]
3F78X-ray1.60A/B/C153-332[»]
3HI6X-ray2.30A/B153-332[»]
3M6FX-ray1.85A154-332[»]
3TCXX-ray3.60B/D/F/H/J/L/N/P/R/T/V/X/Z/b154-332[»]
4IXDX-ray1.80A152-336[»]
5E6RX-ray2.90A26-770[»]
5E6SX-ray2.15A/C/E26-770[»]
5E6UX-ray2.50A26-770[»]
6BXBX-ray2.39A/B153-331[»]
6BXFX-ray3.20A/B153-331[»]
6CKBX-ray2.80A/B153-331[»]
ProteinModelPortaliP20701
SMRiP20701
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109889, 6 interactors
ComplexPortaliCPX-1825 Integrin alphaL-beta2 complex
DIPiDIP-623N
IntActiP20701, 7 interactors
MINTiP20701
STRINGi9606.ENSP00000349252

Chemistry databases

BindingDBiP20701
ChEMBLiCHEMBL1803
DrugBankiDB02177 1-Acetyl-4-(4-{4-[(2-Ethoxyphenyl)Thio]-3-Nitrophenyl}Pyridin-2-Yl)Piperazine
DB00098 Anti-thymocyte Globulin (Rabbit)
DB00095 Efalizumab
DB03932 LFA703
DB11611 Lifitegrast
DB00227 Lovastatin
GuidetoPHARMACOLOGYi2451

PTM databases

GlyConnecti1410
iPTMnetiP20701
PhosphoSitePlusiP20701

Polymorphism and mutation databases

BioMutaiITGAL
DMDMi88911345

Proteomic databases

MaxQBiP20701
PaxDbiP20701
PeptideAtlasiP20701
PRIDEiP20701
ProteomicsDBi53774
53775 [P20701-2]
53776 [P20701-3]

Protocols and materials databases

DNASUi3683
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356798; ENSP00000349252; ENSG00000005844 [P20701-1]
ENST00000358164; ENSP00000350886; ENSG00000005844 [P20701-3]
GeneIDi3683
KEGGihsa:3683
UCSCiuc002dyi.5 human [P20701-1]

Organism-specific databases

CTDi3683
DisGeNETi3683
EuPathDBiHostDB:ENSG00000005844.17
GeneCardsiITGAL
H-InvDBiHIX0012960
HIX0026987
HGNCiHGNC:6148 ITGAL
HPAiCAB025011
MIMi153370 gene
neXtProtiNX_P20701
OpenTargetsiENSG00000005844
PharmGKBiPA29948
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3637 Eukaryota
ENOG410XPVZ LUCA
GeneTreeiENSGT00930000150854
HOGENOMiHOG000113114
HOVERGENiHBG006188
InParanoidiP20701
KOiK05718
OMAiPHSQIPV
OrthoDBiEOG091G03DW
PhylomeDBiP20701
TreeFamiTF105391

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-216083 Integrin cell surface interactions
R-HSA-6798695 Neutrophil degranulation
R-HSA-8949275 RUNX3 Regulates Immune Response and Cell Migration
SignaLinkiP20701
SIGNORiP20701

Miscellaneous databases

ChiTaRSiITGAL human
EvolutionaryTraceiP20701
GeneWikiiCD11a
GenomeRNAii3683
PROiPR:P20701
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000005844 Expressed in 210 organ(s), highest expression level in leukocyte
CleanExiHS_ITGAL
ExpressionAtlasiP20701 baseline and differential
GenevisibleiP20701 HS

Family and domain databases

Gene3Di2.130.10.130, 1 hit
3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 1 hit
PF00357 Integrin_alpha, 1 hit
PF08441 Integrin_alpha2, 1 hit
PF00092 VWA, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
SSF69179 SSF69179, 2 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit
PS50234 VWFA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiITAL_HUMAN
AccessioniPrimary (citable) accession number: P20701
Secondary accession number(s): O43746
, Q45H73, Q96HB1, Q9UBC8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 7, 2006
Last modified: November 7, 2018
This is version 203 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again