Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Atrial natriuretic peptide receptor 2

Gene

NPR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.5 Publications

Catalytic activityi

GTP = 3',5'-cyclic GMP + diphosphate.1 Publication

GO - Molecular functioni

  • ATP binding Source: InterPro
  • GTP binding Source: UniProtKB-KW
  • guanylate cyclase activity Source: UniProtKB
  • hormone binding Source: UniProtKB
  • identical protein binding Source: Ensembl
  • natriuretic peptide receptor activity Source: UniProtKB
  • peptide hormone binding Source: UniProtKB
  • peptide receptor activity Source: GO_Central
  • protein kinase activity Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionLyase, Receptor
Biological processcGMP biosynthesis, Osteogenesis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi4.6.1.2 2681
ReactomeiR-HSA-5578768 Physiological factors

Protein family/group databases

TCDBi8.A.85.1.2 the guanylate cyclase (gc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Atrial natriuretic peptide receptor 2 (EC:4.6.1.21 Publication)
Alternative name(s):
Atrial natriuretic peptide receptor type B
Short name:
ANP-B
Short name:
ANPR-B
Short name:
NPR-B
Guanylate cyclase B
Short name:
GC-B
Gene namesi
Name:NPR2
Synonyms:ANPRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000159899.14
HGNCiHGNC:7944 NPR2
MIMi108961 gene
neXtProtiNX_P20594

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini23 – 458ExtracellularSequence analysisAdd BLAST436
Transmembranei459 – 478HelicalSequence analysisAdd BLAST20
Topological domaini479 – 1047CytoplasmicSequence analysisAdd BLAST569

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Acromesomelic dysplasia, Maroteaux type (AMDM)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive acromesomelic chondrodysplasia. Acromesomelic chondrodysplasias are rare hereditary skeletal disorders characterized by short stature, very short limbs and hand/foot malformations. The severity of limb abnormalities increases from proximal to distal with profoundly affected hands and feet showing brachydactyly and/or rudimentary fingers (knob-like fingers). AMDM is characterized by axial skeletal involvement with wedging of vertebral bodies. In AMDM all skeletal elements are present but show abnormal rates of linear growth.
See also OMIM:602875
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02258332P → T in AMDM. 1 PublicationCorresponds to variant dbSNP:rs28931581EnsemblClinVar.1
Natural variantiVAR_022584115W → G in AMDM; markedly deficient activity. 1 PublicationCorresponds to variant dbSNP:rs28931582EnsemblClinVar.1
Natural variantiVAR_022585176D → E in AMDM. 1 PublicationCorresponds to variant dbSNP:rs28929479EnsemblClinVar.1
Natural variantiVAR_022586297T → M in AMDM; markedly deficient activity. 1 Publication1
Natural variantiVAR_022587338Y → C in AMDM. 1 Publication1
Natural variantiVAR_022588409A → T in AMDM. 1 Publication1
Natural variantiVAR_022589413G → E in AMDM; markedly deficient activity. 1 Publication1
Natural variantiVAR_076481658L → F in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity; loss of natriuretic peptide receptor activity; dominant negative effect. 2 Publications1
Natural variantiVAR_022590708Y → C in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity. 2 Publications1
Natural variantiVAR_022591776R → W in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity. 2 PublicationsCorresponds to variant dbSNP:rs1303913631Ensembl.1
Natural variantiVAR_022592957R → C in AMDM. 1 PublicationCorresponds to variant dbSNP:rs370158184Ensembl.1
Natural variantiVAR_022593959G → A in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity. 2 Publications1
Epiphyseal chondrodysplasia, Miura type (ECDM)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn overgrowth syndrome characterized by tall stature, long hands and feet with arachnodactyly, macrodactyly of the great toes, scoliosis, coxa valga and slipped capital femoral epiphysis.
See also OMIM:615923
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071875488A → P in ECDM; mutant and wild-type alleles have similar expression levels; the mutation results in increased guanylate cyclase activity. 1 PublicationCorresponds to variant dbSNP:rs587777597EnsemblClinVar.1
Natural variantiVAR_071876655R → C in ECDM; the mutation results in increased guanylate cyclase activity. 1 PublicationCorresponds to variant dbSNP:rs587777596EnsemblClinVar.1
Natural variantiVAR_071877882V → M in ECDM; the mutation results in higher guanylate cyclase activity; causes a 15-fold increase in basal Vmax; has higher affinity for GTP than wild-type in the presence of NPPC; might lead to a structural change that locks the enzyme in a conformation mimicking the ATP-bound state. 2 Publications1
Short stature with non-specific skeletal abnormalities (SNSK)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA condition characterized by short stature, defined as a height less than 2 SD below normal, and no endocrine abnormalities.
See also OMIM:616255
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07467876S → P in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; loss of localization to the plasma membrane. 1 PublicationCorresponds to variant dbSNP:rs796065355EnsemblClinVar.1
Natural variantiVAR_074679110R → C in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; retained in the endoplasmic reticulum. 1 PublicationCorresponds to variant dbSNP:rs758478717EnsemblClinVar.1
Natural variantiVAR_074681263R → P in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; loss of localization to the plasma membrane. 1 PublicationCorresponds to variant dbSNP:rs139036657EnsemblClinVar.1
Natural variantiVAR_074682417Q → E in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; no effect on cell surface expression. 1 PublicationCorresponds to variant dbSNP:rs796065356EnsemblClinVar.1
Natural variantiVAR_074683819R → C in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; no effect on cell surface expression. 1 PublicationCorresponds to variant dbSNP:rs766256429EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi24N → D or Q: Decreased glycosylation. Decreased guanylate cyclase activity. 1 Publication1

Keywords - Diseasei

Disease mutation, Dwarfism

Organism-specific databases

DisGeNETi4882
MalaCardsiNPR2
MIMi602875 phenotype
615923 phenotype
616255 phenotype
OpenTargetsiENSG00000159899
Orphaneti40 Acromesomelic dysplasia, Maroteaux type
329191 Tall stature-scoliosis-macrodactyly of the great toes syndrome
PharmGKBiPA257

Chemistry databases

ChEMBLiCHEMBL2111337
DrugBankiDB01613 Erythrityl Tetranitrate
DB04899 Nesiritide
GuidetoPHARMACOLOGYi1748

Polymorphism and mutation databases

BioMutaiNPR2
DMDMi113916

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000001236423 – 1047Atrial natriuretic peptide receptor 2Add BLAST1025

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi24N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi35N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi75 ↔ 101By similarity
Glycosylationi161N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi195N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi244N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi277N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi349N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi439InterchainCurated
Disulfide bondi448InterchainCurated
Modified residuei513Phosphoserine1 Publication1
Modified residuei516Phosphothreonine1 Publication1
Modified residuei518Phosphoserine1 Publication1
Modified residuei522PhosphoserineBy similarity1
Modified residuei523Phosphoserine1 Publication1
Modified residuei526Phosphoserine1 Publication1
Modified residuei529Phosphothreonine1 Publication1

Post-translational modificationi

Phosphorylated (PubMed:26980729). Phosphorylation of the protein kinase-like domain is required for full activation by CNP (By similarity).By similarity1 Publication
Glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiP20594
MaxQBiP20594
PaxDbiP20594
PeptideAtlasiP20594
PRIDEiP20594
ProteomicsDBi53766
53767 [P20594-2]

PTM databases

iPTMnetiP20594
PhosphoSitePlusiP20594

Expressioni

Gene expression databases

BgeeiENSG00000159899 Expressed in 220 organ(s), highest expression level in right uterine tube
CleanExiHS_NPR2
ExpressionAtlasiP20594 baseline and differential
GenevisibleiP20594 HS

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110942, 4 interactors
IntActiP20594, 2 interactors
STRINGi9606.ENSP00000341083

Structurei

3D structure databases

ProteinModelPortaliP20594
SMRiP20594
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini513 – 786Protein kinasePROSITE-ProRule annotationAdd BLAST274
Domaini861 – 991Guanylate cyclasePROSITE-ProRule annotationAdd BLAST131

Sequence similaritiesi

Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1023 Eukaryota
COG2114 LUCA
GeneTreeiENSGT00760000118959
HOVERGENiHBG051862
InParanoidiP20594
KOiK12324
OMAiRFASHWH
OrthoDBiEOG091G02QS
PhylomeDBiP20594
TreeFamiTF106338

Family and domain databases

Gene3Di3.30.70.1230, 1 hit
InterProiView protein in InterPro
IPR001054 A/G_cyclase
IPR018297 A/G_cyclase_CS
IPR001828 ANF_lig-bd_rcpt
IPR001170 ANPR/GUC
IPR011009 Kinase-like_dom_sf
IPR029787 Nucleotide_cyclase
IPR028082 Peripla_BP_I
IPR000719 Prot_kinase_dom
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
PfamiView protein in Pfam
PF01094 ANF_receptor, 1 hit
PF00211 Guanylate_cyc, 1 hit
PF07714 Pkinase_Tyr, 1 hit
PRINTSiPR00255 NATPEPTIDER
SMARTiView protein in SMART
SM00044 CYCc, 1 hit
SUPFAMiSSF53822 SSF53822, 1 hit
SSF55073 SSF55073, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00458 ANF_RECEPTORS, 1 hit
PS00452 GUANYLATE_CYCLASE_1, 1 hit
PS50125 GUANYLATE_CYCLASE_2, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Long (identifier: P20594-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALPSLLLLV AALAGGVRPP GARNLTLAVV LPEHNLSYAW AWPRVGPAVA
60 70 80 90 100
LAVEALGRAL PVDLRFVSSE LEGACSEYLA PLSAVDLKLY HDPDLLLGPG
110 120 130 140 150
CVYPAASVAR FASHWRLPLL TAGAVASGFS AKNDHYRTLV RTGPSAPKLG
160 170 180 190 200
EFVVTLHGHF NWTARAALLY LDARTDDRPH YFTIEGVFEA LQGSNLSVQH
210 220 230 240 250
QVYAREPGGP EQATHFIRAN GRIVYICGPL EMLHEILLQA QRENLTNGDY
260 270 280 290 300
VFFYLDVFGE SLRAGPTRAT GRPWQDNRTR EQAQALREAF QTVLVITYRE
310 320 330 340 350
PPNPEYQEFQ NRLLIRARED FGVELGPSLM NLIAGCFYDG ILLYAEVLNE
360 370 380 390 400
TIQEGGTRED GLRIVEKMQG RRYHGVTGLV VMDKNNDRET DFVLWAMGDL
410 420 430 440 450
DSGDFQPAAH YSGAEKQIWW TGRPIPWVKG APPSDNPPCA FDLDDPSCDK
460 470 480 490 500
TPLSTLAIVA LGTGITFIMF GVSSFLIFRK LMLEKELASM LWRIRWEELQ
510 520 530 540 550
FGNSERYHKG AGSRLTLSLR GSSYGSLMTA HGKYQIFANT GHFKGNVVAI
560 570 580 590 600
KHVNKKRIEL TRQVLFELKH MRDVQFNHLT RFIGACIDPP NICIVTEYCP
610 620 630 640 650
RGSLQDILEN DSINLDWMFR YSLINDLVKG MAFLHNSIIS SHGSLKSSNC
660 670 680 690 700
VVDSRFVLKI TDYGLASFRS TAEPDDSHAL YAKKLWTAPE LLSGNPLPTT
710 720 730 740 750
GMQKADVYSF GIILQEIALR SGPFYLEGLD LSPKEIVQKV RNGQRPYFRP
760 770 780 790 800
SIDRTQLNEE LVLLMERCWA QDPAERPDFG QIKGFIRRFN KEGGTSILDN
810 820 830 840 850
LLLRMEQYAN NLEKLVEERT QAYLEEKRKA EALLYQILPH SVAEQLKRGE
860 870 880 890 900
TVQAEAFDSV TIYFSDIVGF TALSAESTPM QVVTLLNDLY TCFDAIIDNF
910 920 930 940 950
DVYKVETIGD AYMVVSGLPG RNGQRHAPEI ARMALALLDA VSSFRIRHRP
960 970 980 990 1000
HDQLRLRIGV HTGPVCAGVV GLKMPRYCLF GDTVNTASRM ESNGQALKIH
1010 1020 1030 1040
VSSTTKDALD ELGCFQLELR GDVEMKGKGK MRTYWLLGER KGPPGLL
Length:1,047
Mass (Da):117,022
Last modified:February 1, 1991 - v1
Checksum:i817FB74D6B31F7EF
GO
Isoform Short (identifier: P20594-2) [UniParc]FASTAAdd to basket
Also known as: NPR-BI

The sequence of this isoform differs from the canonical sequence as follows:
     964-1047: PVCAGVVGLK...GERKGPPGLL → KADSHSSPSLHLSQTLPTCFFSKGQSVLGLLA

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:995
Mass (Da):111,208
Checksum:i745D41E451E0D7DF
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C1A1H7C1A1_HUMAN
Atrial natriuretic peptide receptor...
NPR2
275Annotation score:
H7C056H7C056_HUMAN
Atrial natriuretic peptide receptor...
NPR2
164Annotation score:
H7C1X0H7C1X0_HUMAN
Atrial natriuretic peptide receptor...
NPR2
76Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti755T → S in BAA81737 (PubMed:10082481).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02258332P → T in AMDM. 1 PublicationCorresponds to variant dbSNP:rs28931581EnsemblClinVar.1
Natural variantiVAR_07467876S → P in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; loss of localization to the plasma membrane. 1 PublicationCorresponds to variant dbSNP:rs796065355EnsemblClinVar.1
Natural variantiVAR_074679110R → C in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; retained in the endoplasmic reticulum. 1 PublicationCorresponds to variant dbSNP:rs758478717EnsemblClinVar.1
Natural variantiVAR_022584115W → G in AMDM; markedly deficient activity. 1 PublicationCorresponds to variant dbSNP:rs28931582EnsemblClinVar.1
Natural variantiVAR_022585176D → E in AMDM. 1 PublicationCorresponds to variant dbSNP:rs28929479EnsemblClinVar.1
Natural variantiVAR_074680187V → I Rare polymorphism; does not affect C-type natriuretic peptide-induced signaling. 1 PublicationCorresponds to variant dbSNP:rs768423636Ensembl.1
Natural variantiVAR_042219232M → I1 PublicationCorresponds to variant dbSNP:rs55747238Ensembl.1
Natural variantiVAR_074681263R → P in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; loss of localization to the plasma membrane. 1 PublicationCorresponds to variant dbSNP:rs139036657EnsemblClinVar.1
Natural variantiVAR_022586297T → M in AMDM; markedly deficient activity. 1 Publication1
Natural variantiVAR_022587338Y → C in AMDM. 1 Publication1
Natural variantiVAR_022588409A → T in AMDM. 1 Publication1
Natural variantiVAR_022589413G → E in AMDM; markedly deficient activity. 1 Publication1
Natural variantiVAR_074682417Q → E in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; no effect on cell surface expression. 1 PublicationCorresponds to variant dbSNP:rs796065356EnsemblClinVar.1
Natural variantiVAR_071875488A → P in ECDM; mutant and wild-type alleles have similar expression levels; the mutation results in increased guanylate cyclase activity. 1 PublicationCorresponds to variant dbSNP:rs587777597EnsemblClinVar.1
Natural variantiVAR_071876655R → C in ECDM; the mutation results in increased guanylate cyclase activity. 1 PublicationCorresponds to variant dbSNP:rs587777596EnsemblClinVar.1
Natural variantiVAR_076481658L → F in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity; loss of natriuretic peptide receptor activity; dominant negative effect. 2 Publications1
Natural variantiVAR_022590708Y → C in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity. 2 Publications1
Natural variantiVAR_011968771Q → E. Corresponds to variant dbSNP:rs5816Ensembl.1
Natural variantiVAR_022591776R → W in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity. 2 PublicationsCorresponds to variant dbSNP:rs1303913631Ensembl.1
Natural variantiVAR_074683819R → C in SNSK; loss of C-type natriuretic peptide-induced signaling; dominant negative effect; no effect on cell surface expression. 1 PublicationCorresponds to variant dbSNP:rs766256429EnsemblClinVar.1
Natural variantiVAR_042220882V → I1 PublicationCorresponds to variant dbSNP:rs55700371EnsemblClinVar.1
Natural variantiVAR_071877882V → M in ECDM; the mutation results in higher guanylate cyclase activity; causes a 15-fold increase in basal Vmax; has higher affinity for GTP than wild-type in the presence of NPPC; might lead to a structural change that locks the enzyme in a conformation mimicking the ATP-bound state. 2 Publications1
Natural variantiVAR_022592957R → C in AMDM. 1 PublicationCorresponds to variant dbSNP:rs370158184Ensembl.1
Natural variantiVAR_022593959G → A in AMDM; no effect on subcellular location; changed glycosylation; no effect on C-type natriuretic peptide binding; decreased guanylate cyclase activity. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001810964 – 1047PVCAG…PPGLL → KADSHSSPSLHLSQTLPTCF FSKGQSVLGLLA in isoform Short. 1 PublicationAdd BLAST84

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005647 Genomic DNA Translation: BAA81737.1
AJ005282 mRNA Translation: CAA06466.1
AL133410 Genomic DNA No translation available.
EU326311 Genomic DNA Translation: ACA05920.1
EU326311 Genomic DNA Translation: ACA05921.1
CH471071 Genomic DNA Translation: EAW58338.1
CH471071 Genomic DNA Translation: EAW58337.1
CH471071 Genomic DNA Translation: EAW58339.1
CH471071 Genomic DNA Translation: EAW58340.1
BC023017 mRNA Translation: AAH23017.1
CCDSiCCDS6590.1 [P20594-1]
PIRiS05514 OYHUBR
RefSeqiNP_003986.2, NM_003995.3 [P20594-1]
UniGeneiHs.78518

Genome annotation databases

EnsembliENST00000342694; ENSP00000341083; ENSG00000159899 [P20594-1]
GeneIDi4882
KEGGihsa:4882
UCSCiuc003zyd.4 human [P20594-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005647 Genomic DNA Translation: BAA81737.1
AJ005282 mRNA Translation: CAA06466.1
AL133410 Genomic DNA No translation available.
EU326311 Genomic DNA Translation: ACA05920.1
EU326311 Genomic DNA Translation: ACA05921.1
CH471071 Genomic DNA Translation: EAW58338.1
CH471071 Genomic DNA Translation: EAW58337.1
CH471071 Genomic DNA Translation: EAW58339.1
CH471071 Genomic DNA Translation: EAW58340.1
BC023017 mRNA Translation: AAH23017.1
CCDSiCCDS6590.1 [P20594-1]
PIRiS05514 OYHUBR
RefSeqiNP_003986.2, NM_003995.3 [P20594-1]
UniGeneiHs.78518

3D structure databases

ProteinModelPortaliP20594
SMRiP20594
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110942, 4 interactors
IntActiP20594, 2 interactors
STRINGi9606.ENSP00000341083

Chemistry databases

ChEMBLiCHEMBL2111337
DrugBankiDB01613 Erythrityl Tetranitrate
DB04899 Nesiritide
GuidetoPHARMACOLOGYi1748

Protein family/group databases

TCDBi8.A.85.1.2 the guanylate cyclase (gc) family

PTM databases

iPTMnetiP20594
PhosphoSitePlusiP20594

Polymorphism and mutation databases

BioMutaiNPR2
DMDMi113916

Proteomic databases

EPDiP20594
MaxQBiP20594
PaxDbiP20594
PeptideAtlasiP20594
PRIDEiP20594
ProteomicsDBi53766
53767 [P20594-2]

Protocols and materials databases

DNASUi4882
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342694; ENSP00000341083; ENSG00000159899 [P20594-1]
GeneIDi4882
KEGGihsa:4882
UCSCiuc003zyd.4 human [P20594-1]

Organism-specific databases

CTDi4882
DisGeNETi4882
EuPathDBiHostDB:ENSG00000159899.14
GeneCardsiNPR2
H-InvDBiHIX0034787
HGNCiHGNC:7944 NPR2
MalaCardsiNPR2
MIMi108961 gene
602875 phenotype
615923 phenotype
616255 phenotype
neXtProtiNX_P20594
OpenTargetsiENSG00000159899
Orphaneti40 Acromesomelic dysplasia, Maroteaux type
329191 Tall stature-scoliosis-macrodactyly of the great toes syndrome
PharmGKBiPA257
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1023 Eukaryota
COG2114 LUCA
GeneTreeiENSGT00760000118959
HOVERGENiHBG051862
InParanoidiP20594
KOiK12324
OMAiRFASHWH
OrthoDBiEOG091G02QS
PhylomeDBiP20594
TreeFamiTF106338

Enzyme and pathway databases

BRENDAi4.6.1.2 2681
ReactomeiR-HSA-5578768 Physiological factors

Miscellaneous databases

ChiTaRSiNPR2 human
GeneWikiiNPR2
GenomeRNAii4882
PROiPR:P20594
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000159899 Expressed in 220 organ(s), highest expression level in right uterine tube
CleanExiHS_NPR2
ExpressionAtlasiP20594 baseline and differential
GenevisibleiP20594 HS

Family and domain databases

Gene3Di3.30.70.1230, 1 hit
InterProiView protein in InterPro
IPR001054 A/G_cyclase
IPR018297 A/G_cyclase_CS
IPR001828 ANF_lig-bd_rcpt
IPR001170 ANPR/GUC
IPR011009 Kinase-like_dom_sf
IPR029787 Nucleotide_cyclase
IPR028082 Peripla_BP_I
IPR000719 Prot_kinase_dom
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
PfamiView protein in Pfam
PF01094 ANF_receptor, 1 hit
PF00211 Guanylate_cyc, 1 hit
PF07714 Pkinase_Tyr, 1 hit
PRINTSiPR00255 NATPEPTIDER
SMARTiView protein in SMART
SM00044 CYCc, 1 hit
SUPFAMiSSF53822 SSF53822, 1 hit
SSF55073 SSF55073, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00458 ANF_RECEPTORS, 1 hit
PS00452 GUANYLATE_CYCLASE_1, 1 hit
PS50125 GUANYLATE_CYCLASE_2, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiANPRB_HUMAN
AccessioniPrimary (citable) accession number: P20594
Secondary accession number(s): B0ZBF2
, B0ZBF3, D3DRP3, D3DRP4, O60871, Q4VAK7, Q5TCV2, Q8TA93, Q9UQ50
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: November 7, 2018
This is version 203 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again