UniProtKB - P20340 (RAB6A_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A PE=1 SV=3 MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR TVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST QDRSREDMIDIKLEKPQEQPVSEGGCSC
- Align
Ras-related protein Rab-6A
RAB6A
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.33"Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport."
Matsuto M., Kano F., Murata M.
Biochim. Biophys. Acta 1853:2592-2609(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH BICD2, SUBCELLULAR LOCATION, ISOPRENYLATION.
Regions
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi | 20 – 28 | GTP3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 9 | |
| <p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi | 68 – 72 | GTP3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 5 | |
| <p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi | 126 – 129 | GTP3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 4 | |
| <p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi | 156 – 158 | GTP3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 3 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- GTPase activity Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- GTP binding Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- myosin V binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- protein domain specific binding Source: BHF-UCL <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- antigen processing and presentation Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- early endosome to Golgi transport Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- minus-end-directed organelle transport along microtubule Source: BHF-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- neutrophil degranulation Source: Reactome
- peptidyl-cysteine methylation Source: MGI <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- protein localization to Golgi apparatus Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- protein transport Source: UniProtKB-KW
- retrograde vesicle-mediated transport, Golgi to ER Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- viral process Source: UniProtKB-KW
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Biological process | ER-Golgi transport, Host-virus interaction, Protein transport, Transport |
| Ligand | GTP-binding, Nucleotide-binding |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-1912420 Pre-NOTCH Processing in Golgi R-HSA-6798695 Neutrophil degranulation R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic R-HSA-6811440 Retrograde transport at the Trans-Golgi-Network R-HSA-8854214 TBC/RABGAPs R-HSA-8873719 RAB geranylgeranylation R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Ras-related protein Rab-6AShort name: Rab-6 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:RAB6A Synonyms:RAB6 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000175582.19 |
Human Gene Nomenclature Database More...HGNCi | HGNC:9786 RAB6A |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 179513 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P20340 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Golgi apparatus
- Golgi apparatus membrane 2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.26"Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase."
Pusapati G.V., Luchetti G., Pfeffer S.R.
J. Biol. Chem. 287:42129-42137(2012) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH RIC1 AND RGP1, SUBCELLULAR LOCATION, MUTAGENESIS OF THR-27. - Ref.33"Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport."
Matsuto M., Kano F., Murata M.
Biochim. Biophys. Acta 1853:2592-2609(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH BICD2, SUBCELLULAR LOCATION, ISOPRENYLATION.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.33"Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport."
Matsuto M., Kano F., Murata M.
Biochim. Biophys. Acta 1853:2592-2609(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH BICD2, SUBCELLULAR LOCATION, ISOPRENYLATION.
Note: BICD2 facilitates its targeting to Golgi apparatus membrane.1 Publication- Golgi apparatus membrane 2 Publications
- Ref.33"Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport."
Matsuto M., Kano F., Murata M.
Biochim. Biophys. Acta 1853:2592-2609(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH BICD2, SUBCELLULAR LOCATION, ISOPRENYLATION.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
Golgi apparatus
- Golgi apparatus membrane 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.4"Alternative splicing of the human Rab6A gene generates two close but functionally different isoforms."
Echard A., Opdam F.J.M., de Leeuw H.J.P.C., Jollivet F., Savelkoul P., Hendriks W., Voorberg J., Goud B., Fransen J.A.M.
Mol. Biol. Cell 11:3819-3833(2000) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, CHARACTERIZATION, SUBCELLULAR LOCATION (ISOFORMS 1 AND 2).
- Golgi apparatus membrane 1 Publication
Golgi apparatus
- Golgi apparatus membrane 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.4"Alternative splicing of the human Rab6A gene generates two close but functionally different isoforms."
Echard A., Opdam F.J.M., de Leeuw H.J.P.C., Jollivet F., Savelkoul P., Hendriks W., Voorberg J., Goud B., Fransen J.A.M.
Mol. Biol. Cell 11:3819-3833(2000) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, CHARACTERIZATION, SUBCELLULAR LOCATION (ISOFORMS 1 AND 2).
- Golgi apparatus membrane 1 Publication
Cytosol
- cytosol Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Endoplasmic reticulum
- endoplasmic reticulum membrane Source: Reactome
Extracellular region or secreted
- extracellular exosome Source: UniProtKBInferred from high throughput direct assayi
Golgi apparatus
- Golgi apparatus Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- Golgi membrane Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- trans-Golgi network Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- trans-Golgi network membrane Source: Reactome
Plasma Membrane
- plasma membrane Source: Reactome
Other locations
- cytoplasmic vesicle Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- endosome to plasma membrane transport vesicle Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- membrane Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- secretory granule membrane Source: Reactome
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Golgi apparatus, Membrane<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 27 | T → N: Loss of APBA1-binding. No loss of RIC1- and RGP1-binding. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 46 | I → E: Loss of RAB6IP1-binding. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 72 | Q → L: Loss of GTPase activity. Interacts with APBA1. 4 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Organism-specific databases
DisGeNET More...DisGeNETi | 5870 |
Open Targets More...OpenTargetsi | ENSG00000175582 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA34146 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | RAB6A |
Domain mapping of disease mutations (DMDM) More...DMDMi | 131796 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methioninei | RemovedCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini | |||
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000121112 | 2 – 208 | Ras-related protein Rab-6AAdd BLAST | 207 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 2 | N-acetylserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini | 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 82 | O-AMP-tyrosine; by Legionella DrrA1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 184 | PhosphoserineBy similarity <p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi | 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi | 206 | S-geranylgeranyl cysteineBy similarity | 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 208 | Cysteine methyl esterBy similarity | 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi | 208 | S-geranylgeranyl cysteineBy similarity | 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.33"Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport."
Matsuto M., Kano F., Murata M.
Biochim. Biophys. Acta 1853:2592-2609(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH BICD2, SUBCELLULAR LOCATION, ISOPRENYLATION.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Acetylation, Lipoprotein, Methylation, Phosphoprotein, PrenylationProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P20340 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P20340 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P20340 |
PeptideAtlas More...PeptideAtlasi | P20340 |
PRoteomics IDEntifications database More...PRIDEi | P20340 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 53752 53753 [P20340-2] |
Consortium for Top Down Proteomics More...TopDownProteomicsi | P20340-2 [P20340-2] |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P20340 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P20340 |
SwissPalm database of S-palmitoylation events More...SwissPalmi | P20340 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.4"Alternative splicing of the human Rab6A gene generates two close but functionally different isoforms."
Echard A., Opdam F.J.M., de Leeuw H.J.P.C., Jollivet F., Savelkoul P., Hendriks W., Voorberg J., Goud B., Fransen J.A.M.
Mol. Biol. Cell 11:3819-3833(2000) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, CHARACTERIZATION, SUBCELLULAR LOCATION (ISOFORMS 1 AND 2).
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000175582 |
CleanEx database of gene expression profiles More...CleanExi | HS_RAB6A |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P20340 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P20340 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | CAB009936 HPA059131 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
<p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi
16 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.13"Characterization of GAPCenA, a GTPase activating protein for Rab6, part of which associates with the centrosome."
Cuif M.-H., Possmayer F., Zander H., Bordes N., Jollivet F., Couedel-Courteille A., Janoueix-Lerosey I., Langsley G., Bornens M., Goud B.
EMBO J. 18:1772-1782(1999) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH RABGAP1. - Ref.14"Bicaudal-D regulates COPI-independent Golgi-ER transport by recruiting the dynein-dynactin motor complex."
Matanis T., Akhmanova A., Wulf P., Del Nery E., Weide T., Stepanova T., Galjart N., Grosveld F., Goud B., De Zeeuw C.I., Barnekow A., Hoogenraad C.C.
Nat. Cell Biol. 4:986-992(2002) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH BICD1 AND BICD2. - Ref.15"Characterization of the human GARP (Golgi associated retrograde protein) complex."
Liewen H., Meinhold-Heerlein I., Oliveira V., Schwarzenbacher R., Luo G., Wadle A., Jung M., Pfreundschuh M., Stenner-Liewen F.
Exp. Cell Res. 306:24-34(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH VSP52. - Ref.16"Functional involvement of TMF/ARA160 in Rab6-dependent retrograde membrane traffic."
Yamane J., Kubo A., Nakayama K., Yuba-Kubo A., Katsuno T., Tsukita S., Tsukita S.
Exp. Cell Res. 313:3472-3485(2007) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH TMF1. - Ref.17"Rab6 family proteins interact with the dynein light chain protein DYNLRB1."
Wanschers B.F.J., van de Vorstenbosch R., Wijers M., Wieringa B., King S.M., Fransen J.
Cell Motil. Cytoskeleton 65:183-196(2008) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH DYNLRB1. - Ref.18"Gerodermia osteodysplastica is caused by mutations in SCYL1BP1, a Rab-6 interacting golgin."
Hennies H.C., Kornak U., Zhang H., Egerer J., Zhang X., Seifert W., Kuhnisch J., Budde B., Naetebus M., Brancati F., Wilcox W.R., Mueller D., Kaplan P.B., Rajab A., Zampino G., Fodale V., Dallapiccola B., Newman W. , Metcalfe K., Clayton-Smith J., Tassabehji M., Steinmann B., Barr F.A., Nuernberg P., Wieacker P., Mundlos S.
Nat. Genet. 40:1410-1412(2008) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH SCYL1BP1. - Ref.20"Pitchfork regulates primary cilia disassembly and left-right asymmetry."
Kinzel D., Boldt K., Davis E.E., Burtscher I., Trumbach D., Diplas B., Attie-Bitach T., Wurst W., Katsanis N., Ueffing M., Lickert H.
Dev. Cell 19:66-77(2010) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH PIFO. - Ref.21"Bicaudal D2, dynein, and kinesin-1 associate with nuclear pore complexes and regulate centrosome and nuclear positioning during mitotic entry."
Splinter D., Tanenbaum M.E., Lindqvist A., Jaarsma D., Flotho A., Yu K.L., Grigoriev I., Engelsma D., Haasdijk E.D., Keijzer N., Demmers J., Fornerod M., Melchior F., Hoogenraad C.C., Medema R.H., Akhmanova A.
PLoS Biol. 8:E1000350-E1000350(2010) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH BICD2. - Ref.26"Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase."
Pusapati G.V., Luchetti G., Pfeffer S.R.
J. Biol. Chem. 287:42129-42137(2012) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH RIC1 AND RGP1, SUBCELLULAR LOCATION, MUTAGENESIS OF THR-27. - Ref.29"Molecular defects in the motor adaptor BICD2 cause proximal spinal muscular atrophy with autosomal-dominant inheritance."
Peeters K., Litvinenko I., Asselbergh B., Almeida-Souza L., Chamova T., Geuens T., Ydens E., Zimon M., Irobi J., De Vriendt E., De Winter V., Ooms T., Timmerman V., Tournev I., Jordanova A.
Am. J. Hum. Genet. 92:955-964(2013) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH BICD2. - Ref.31"A new Mint1 isoform, but not the conventional Mint1, interacts with the small GTPase Rab6."
Thyrock A., Ossendorf E., Stehling M., Kail M., Kurtz T., Pohlentz G., Waschbusch D., Eggert S., Formstecher E., Muthing J., Dreisewerd K., Kins S., Goud B., Barnekow A.
PLoS ONE 8:E64149-E64149(2013) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH APBA1, MUTAGENESIS OF THR-27 AND GLN-72. - Ref.33"Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport."
Matsuto M., Kano F., Murata M.
Biochim. Biophys. Acta 1853:2592-2609(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH BICD2, SUBCELLULAR LOCATION, ISOPRENYLATION. - Ref.35"Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8A resolution."
Bergbrede T., Pylypenko O., Rak A., Alexandrov K.
J. Struct. Biol. 152:235-238(2005) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.82 ANGSTROMS) OF 13-174 IN COMPLEX WITH GTP, MUTAGENESIS OF GLN-72. - Ref.36"Structural basis of family-wide Rab GTPase recognition by rabenosyn-5."
Eathiraj S., Pan X., Ritacco C., Lambright D.G.
Nature 436:415-419(2005) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.78 ANGSTROMS) OF 10-177 IN COMPLEX WITH GTP ANALOG. - Ref.37"Rab and Arl GTPase family members cooperate in the localization of the golgin GCC185."
Burguete A.S., Fenn T.D., Brunger A.T., Pfeffer S.R.
Cell 132:286-298(2008) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 1-206 IN COMPLEX WITH GTP, INTERACTION WITH GCC2, MUTAGENESIS OF GLN-72. - Ref.38"Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain."
Recacha R., Boulet A., Jollivet F., Monier S., Houdusse A., Goud B., Khan A.R.
Structure 17:21-30(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 8-195 IN COMPLEX WITH GTP AND RAB6IP1, MUTAGENESIS OF ILE-46 AND GLN-72.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.24"A role for the small GTPase Rab6 in assembly of human cytomegalovirus."
Indran S.V., Britt W.J.
J. Virol. 85:5213-5219(2011) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH HUMAN CYOMEGALOVIRUS PROTEIN UL32 (MICROBIAL INFECTION).
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| APBA1 | Q02410-2 | 4 | EBI-8851226,EBI-9247455 | |
| Dennd5a | Q6PAL8 | 4 | EBI-8851226,EBI-15750630 | From Mus musculus. |
| GCC2 | Q8IWJ2 | 4 | EBI-1052826,EBI-1645320 | |
| lpg0940 | Q5ZWZ3 | 2 | EBI-8851226,EBI-6417967 | From Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513). |
| OCRL | Q01968 | 13 | EBI-1052826,EBI-6148898 | |
| PMM1 | Q92871 | 4 | EBI-1052826,EBI-746784 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- myosin V binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- protein domain specific binding Source: BHF-UCL <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 111808, 43 interactors |
Database of interacting proteins More...DIPi | DIP-39668N |
Protein interaction database and analysis system More...IntActi | P20340, 27 interactors |
Molecular INTeraction database More...MINTi | P20340 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000311449 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 15 – 21 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 26 – 35 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 47 – 56 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 61 – 69 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 73 – 78 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 79 – 83 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 87 – 94 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 98 – 102 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 104 – 115 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 12 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 118 – 126 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 128 – 130 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 131 – 133 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 138 – 147 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 151 – 154 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 157 – 159 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 163 – 173 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 11 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P20340 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P20340 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P20340 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Motif
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi | 42 – 50 | Effector regionBy similarity | 9 |
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG0094 Eukaryota ENOG410XPBI LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00910000144073 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000233968 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG009351 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P20340 |
KEGG Orthology (KO) More...KOi | K07893 |
Identification of Orthologs from Complete Genome Data More...OMAi | MYQATIG |
Database of Orthologous Groups More...OrthoDBi | EOG091G0ORZ |
Database for complete collections of gene phylogenies More...PhylomeDBi | P20340 |
TreeFam database of animal gene trees More...TreeFami | TF300803 |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR027417 P-loop_NTPase IPR005225 Small_GTP-bd_dom IPR001806 Small_GTPase |
Pfam protein domain database More...Pfami | View protein in Pfam PF00071 Ras, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF52540 SSF52540, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00231 small_GTP, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51419 RAB, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MSTGGDFGNP LRKFKLVFLG EQSVGKTSLI TRFMYDSFDN TYQATIGIDF
60 70 80 90 100
LSKTMYLEDR TVRLQLWDTA GQERFRSLIP SYIRDSTVAV VVYDITNVNS
110 120 130 140 150
FQQTTKWIDD VRTERGSDVI IMLVGNKTDL ADKRQVSIEE GERKAKELNV
160 170 180 190 200
MFIETSAKAG YNVKQLFRRV AAALPGMEST QDRSREDMID IKLEKPQEQP
VSEGGCSC
The sequence of this isoform differs from the canonical sequence as follows:
62-88: VRLQLWDTAGQERFRSLIPSYIRDSTV → IRLQLWDTAGQERFRSLIPSYIRDSAA
10 20 30 40 50
MSTGGDFGNP LRKFKLVFLG EQSVGKTSLI TRFMYDSFDN TYQATIGIDF
60 70 80 90 100
LSKTMYLEDR TIRLQLWDTA GQERFRSLIP SYIRDSAAAV VVYDITNVNS
110 120 130 140 150
FQQTTKWIDD VRTERGSDVI IMLVGNKTDL ADKRQVSIEE GERKAKELNV
160 170 180 190 200
MFIETSAKAG YNVKQLFRRV AAALPGMEST QDRSREDMID IKLEKPQEQP
VSEGGCSC
The sequence of this isoform differs from the canonical sequence as follows:
62-165: Missing.
10 20 30 40 50
MSTGGDFGNP LRKFKLVFLG EQSVGKTSLI TRFMYDSFDN TYQATIGIDF
60 70 80 90 100
LSKTMYLEDR TLFRRVAAAL PGMESTQDRS REDMIDIKLE KPQEQPVSEG
GCSC
The sequence of this isoform differs from the canonical sequence as follows:
1-33: Missing.
62-88: VRLQLWDTAGQERFRSLIPSYIRDSTV → IRLQLWDTAGQERFRSLIPSYIRDSAA
10 20 30 40 50
MYDSFDNTYQ ATIGIDFLSK TMYLEDRTIR LQLWDTAGQE RFRSLIPSYI
60 70 80 90 100
RDSAAAVVVY DITNVNSFQQ TTKWIDDVRT ERGSDVIIML VGNKTDLADK
110 120 130 140 150
RQVSIEEGER KAKELNVMFI ETSAKAGYNV KQLFRRVAAA LPGMESTQDR
160 170
SREDMIDIKL EKPQEQPVSE GGCSC
Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 189 | I → T in BAH13508 (PubMed:14702039).Curated | 1 |
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046967 | 1 – 33 | Missing in isoform 4. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 33 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045302 | 62 – 165 | Missing in isoform 3. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 104 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005527 | 62 – 88 | VRLQL…RDSTV → IRLQLWDTAGQERFRSLIPS YIRDSAA in isoform 2 and isoform 4. 6 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 27 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | M28212 mRNA Translation: AAA60246.1 AF130986 mRNA Translation: AAD25535.1 AF119836 mRNA Translation: AAF23593.1 AF198616 mRNA Translation: AAF73841.1 AF130122 mRNA Translation: AAD27707.1 DQ437503 mRNA Translation: ABD93919.1 AK057157 mRNA Translation: BAB71371.1 AK289748 mRNA Translation: BAF82437.1 AK290132 mRNA Translation: BAF82821.1 AK301534 mRNA Translation: BAH13508.1 AF498939 mRNA Translation: AAM21087.1 AF498941 mRNA Translation: AAM21089.1 BT019698 mRNA Translation: AAV38504.1 AP002770 Genomic DNA No translation available. AP002993 Genomic DNA No translation available. BC003617 mRNA Translation: AAH03617.1 BC068486 mRNA Translation: AAH68486.1 BC096818 mRNA Translation: AAH96818.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS58155.1 [P20340-4] CCDS58156.1 [P20340-3] CCDS8223.1 [P20340-2] CCDS8224.1 [P20340-1] |
Protein sequence database of the Protein Information Resource More...PIRi | G34323 |
NCBI Reference Sequences More...RefSeqi | NP_001230647.1, NM_001243718.1 [P20340-3] NP_001230648.1, NM_001243719.1 [P20340-4] NP_002860.2, NM_002869.4 [P20340-2] NP_942599.1, NM_198896.1 [P20340-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.503222 Hs.591552 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000310653; ENSP00000311449; ENSG00000175582 [P20340-2] ENST00000336083; ENSP00000336850; ENSG00000175582 [P20340-1] ENST00000541588; ENSP00000445350; ENSG00000175582 [P20340-3] ENST00000541973; ENSP00000443782; ENSG00000175582 [P20340-4] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 5870 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:5870 |
UCSC genome browser More...UCSCi | uc001oue.4 human [P20340-1] |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P20340 | Ras-related protein Rab-6A | 208 | |||
| H.sapiens ras-related Hrab6 protein | 208 | ||||
| RAB6A isoform 3 | 208 | ||||
| Uncharacterized protein | 208 | ||||
| Uncharacterized protein | 208 | ||||
| +4 | |||||
| P20340-2 | RAB6A, member RAS oncogene family, isoform CRA_b | 208 | |||
| RAB6A isoform 1 | 208 | ||||
| Uncharacterized protein | 208 | ||||
| Uncharacterized protein | 208 | ||||
| Uncharacterized protein | 208 | ||||
| P20340-3 | RAB6A isoform 5 | 104 | |||
| Uncharacterized protein | 104 | ||||
| Uncharacterized protein | 104 | ||||
| P20340-4 | Ras-related protein Rab-6A isoform a | 208 | |||
| RAB6A, member RAS oncogene family | 208 | ||||
| Ras-related protein Rab-6A isoform a | 208 | ||||
| RAB6A, member RAS oncogene family | 208 | ||||
| ras-related protein Rab-6A isoform X2 | 208 | ||||
| +22 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P20340 | Ras-related protein Rab-6A | 208 | |||
| H.sapiens ras-related Hrab6 protein | 208 | ||||
| RAB6A isoform 3 | 208 | ||||
| Uncharacterized protein | 208 | ||||
| Uncharacterized protein | 208 | ||||
| +217 | |||||
| P20340-3 | RAB6A isoform 5 | 104 | |||
| Uncharacterized protein | 104 | ||||
| Uncharacterized protein | 104 | ||||
| Uncharacterized protein | 104 | ||||
| Uncharacterized protein | 104 | ||||
| +23 | |||||
| P20340-4 | Uncharacterized protein | 255 | |||
| UPI0004406FD0 | 258 | ||||
| UPI00083FD0BC | 258 | ||||
| UPI00057BC22C | 257 | ||||
| UPI000523C4D0 | 224 | ||||
| +40 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P20340 | Ras-related protein Rab-6A | 208 | |||
| H.sapiens ras-related Hrab6 protein | 208 | ||||
| RAB6A isoform 3 | 208 | ||||
| Uncharacterized protein | 208 | ||||
| Uncharacterized protein | 208 | ||||
| +319 | |||||
| P20340-3 | RAB6A isoform 5 | 104 | |||
| Uncharacterized protein | 104 | ||||
| Uncharacterized protein | 104 | ||||
| UPI0003F05ED9 | 104 | ||||
| UPI0003331859 | 104 | ||||
| +37 | |||||
| P20340-4 | Uncharacterized protein | 255 | |||
| UPI0004406FD0 | 258 | ||||
| UPI00083FD0BC | 258 | ||||
| UPI00057BC22C | 257 | ||||
| UPI000523BB0E | 224 | ||||
| +49 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | M28212 mRNA Translation: AAA60246.1 AF130986 mRNA Translation: AAD25535.1 AF119836 mRNA Translation: AAF23593.1 AF198616 mRNA Translation: AAF73841.1 AF130122 mRNA Translation: AAD27707.1 DQ437503 mRNA Translation: ABD93919.1 AK057157 mRNA Translation: BAB71371.1 AK289748 mRNA Translation: BAF82437.1 AK290132 mRNA Translation: BAF82821.1 AK301534 mRNA Translation: BAH13508.1 AF498939 mRNA Translation: AAM21087.1 AF498941 mRNA Translation: AAM21089.1 BT019698 mRNA Translation: AAV38504.1 AP002770 Genomic DNA No translation available. AP002993 Genomic DNA No translation available. BC003617 mRNA Translation: AAH03617.1 BC068486 mRNA Translation: AAH68486.1 BC096818 mRNA Translation: AAH96818.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS58155.1 [P20340-4] CCDS58156.1 [P20340-3] CCDS8223.1 [P20340-2] CCDS8224.1 [P20340-1] |
Protein sequence database of the Protein Information Resource More...PIRi | G34323 |
NCBI Reference Sequences More...RefSeqi | NP_001230647.1, NM_001243718.1 [P20340-3] NP_001230648.1, NM_001243719.1 [P20340-4] NP_002860.2, NM_002869.4 [P20340-2] NP_942599.1, NM_198896.1 [P20340-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.503222 Hs.591552 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1YZQ | X-ray | 1.78 | A | 10-177 | [»] | |
| 2GIL | X-ray | 1.82 | A/B/C/D | 13-174 | [»] | |
| 3BBP | X-ray | 3.00 | A/B/C | 1-206 | [»] | |
| 3CWZ | X-ray | 3.20 | A | 8-195 | [»] | |
| 4DKX | X-ray | 1.90 | A/B | 1-208 | [»] | |
| 5LEF | X-ray | 2.09 | A/B | 8-195 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P20340 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P20340 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 111808, 43 interactors |
Database of interacting proteins More...DIPi | DIP-39668N |
Protein interaction database and analysis system More...IntActi | P20340, 27 interactors |
Molecular INTeraction database More...MINTi | P20340 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000311449 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P20340 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P20340 |
SwissPalm database of S-palmitoylation events More...SwissPalmi | P20340 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | RAB6A |
Domain mapping of disease mutations (DMDM) More...DMDMi | 131796 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P20340 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P20340 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P20340 |
PeptideAtlas More...PeptideAtlasi | P20340 |
PRoteomics IDEntifications database More...PRIDEi | P20340 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 53752 53753 [P20340-2] |
Consortium for Top Down Proteomics More...TopDownProteomicsi | P20340-2 [P20340-2] |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 5870 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000310653; ENSP00000311449; ENSG00000175582 [P20340-2] ENST00000336083; ENSP00000336850; ENSG00000175582 [P20340-1] ENST00000541588; ENSP00000445350; ENSG00000175582 [P20340-3] ENST00000541973; ENSP00000443782; ENSG00000175582 [P20340-4] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 5870 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:5870 |
UCSC genome browser More...UCSCi | uc001oue.4 human [P20340-1] |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 5870 |
DisGeNET More...DisGeNETi | 5870 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000175582.19 |
GeneCards: human genes, protein and diseases More...GeneCardsi | RAB6A |
Human Gene Nomenclature Database More...HGNCi | HGNC:9786 RAB6A |
Human Protein Atlas More...HPAi | CAB009936 HPA059131 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 179513 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P20340 |
Open Targets More...OpenTargetsi | ENSG00000175582 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA34146 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG0094 Eukaryota ENOG410XPBI LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00910000144073 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000233968 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG009351 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P20340 |
KEGG Orthology (KO) More...KOi | K07893 |
Identification of Orthologs from Complete Genome Data More...OMAi | MYQATIG |
Database of Orthologous Groups More...OrthoDBi | EOG091G0ORZ |
Database for complete collections of gene phylogenies More...PhylomeDBi | P20340 |
TreeFam database of animal gene trees More...TreeFami | TF300803 |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-1912420 Pre-NOTCH Processing in Golgi R-HSA-6798695 Neutrophil degranulation R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic R-HSA-6811440 Retrograde transport at the Trans-Golgi-Network R-HSA-8854214 TBC/RABGAPs R-HSA-8873719 RAB geranylgeranylation R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | RAB6A human |
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P20340 |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | RAB6A |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 5870 |
Protein Ontology More...PROi | PR:P20340 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000175582 |
CleanEx database of gene expression profiles More...CleanExi | HS_RAB6A |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P20340 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P20340 HS |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR027417 P-loop_NTPase IPR005225 Small_GTP-bd_dom IPR001806 Small_GTPase |
Pfam protein domain database More...Pfami | View protein in Pfam PF00071 Ras, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF52540 SSF52540, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00231 small_GTP, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51419 RAB, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | RAB6A_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P20340Primary (citable) accession number: P20340 Secondary accession number(s): A8K133 , B7Z772, F5H668, Q1W5D8, Q5U0A8, Q9UBE4 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | February 1, 1991 |
| Last sequence update: | January 23, 2007 | |
| Last modified: | July 18, 2018 | |
| This is version 211 of the entry and version 3 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Direct protein sequencing, Reference proteomeDocuments
- Human chromosome 11
Human chromosome 11: entries, gene names and cross-references to MIM - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references - SIMILARITY comments
Index of protein domains and families
