UniProtKB - P20279 (RL3_HALMA)

BLAST

>sp|P20279|RL3_HALMA 50S ribosomal protein L3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl3 PE=1 SV=5
MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPN
SPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDH
DPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHAL
DIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKG
SVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG

Align
Format
Add to basket Added to basket
History
Entry version 128 (10 Oct 2018)
Sequence version 5 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L3

Gene

rpl3

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.By similarity

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L3 Alternative name(s): Hl1 Hmal3
Gene namesⁱ	Name:rpl3 Ordered Locus Names:rrnAC1611
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed
ChainⁱPRO_0000077207	2 – 338	50S ribosomal protein L3Add BLAST		337

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Forms a cluster with proteins L14 and L24e. Interacts weakly with protein L13.2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1611

STRINGⁱ

272569.rrnAC1611

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	12 – 14	Combined sources	3
Beta strandⁱ	35 – 39	Combined sources	5
Beta strandⁱ	42 – 55	Combined sources	14
Beta strandⁱ	59 – 61	Combined sources	3
Turnⁱ	62 – 65	Combined sources	4
Beta strandⁱ	66 – 76	Combined sources	11
Beta strandⁱ	80 – 91	Combined sources	12
Beta strandⁱ	94 – 102	Combined sources	9
Helixⁱ	110 – 112	Combined sources	3
Helixⁱ	122 – 135	Combined sources	14
Beta strandⁱ	138 – 146	Combined sources	9
Helixⁱ	149 – 151	Combined sources	3
Beta strandⁱ	153 – 155	Combined sources	3
Beta strandⁱ	162 – 168	Combined sources	7
Helixⁱ	172 – 185	Combined sources	14
Beta strandⁱ	187 – 189	Combined sources	3
Turnⁱ	192 – 194	Combined sources	3
Beta strandⁱ	200 – 206	Combined sources	7
Beta strandⁱ	209 – 213	Combined sources	5
Helixⁱ	215 – 219	Combined sources	5
Helixⁱ	226 – 229	Combined sources	4
Beta strandⁱ	230 – 232	Combined sources	3
Beta strandⁱ	234 – 236	Combined sources	3
Beta strandⁱ	243 – 247	Combined sources	5
Beta strandⁱ	250 – 252	Combined sources	3
Beta strandⁱ	256 – 259	Combined sources	4
Beta strandⁱ	262 – 279	Combined sources	18
Turnⁱ	286 – 288	Combined sources	3
Beta strandⁱ	293 – 300	Combined sources	8
Beta strandⁱ	309 – 314	Combined sources	6
Beta strandⁱ	328 – 331	Combined sources	4

Show more details

3D structure databases

ProteinModelPortalⁱ	P20279
SMRⁱ	P20279
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P20279

EvolutionaryTraceⁱ

P20279

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the universal ribosomal protein uL3 family.Curated

Phylogenomic databases

eggNOGⁱ	arCOG04070 Archaea COG0087 LUCA
HOGENOMⁱ	HOG000107320
KEGG Orthology (KO) More...KOⁱ	K02906
OMAⁱ	HQRTEYN
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z05KT

Family and domain databases

HAMAPⁱ	MF_01325_A Ribosomal_L3_A, 1 hit
InterProⁱ	View protein in InterPro IPR000597 Ribosomal_L3 IPR019928 Ribosomal_L3_arc IPR019926 Ribosomal_L3_CS IPR009000 Transl_B-barrel_sf
PANTHERⁱ	PTHR11363:SF5 PTHR11363:SF5, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00297 Ribosomal_L3, 1 hit
SUPFAMⁱ	SSF50447 SSF50447, 1 hit
TIGRFAMsⁱ	TIGR03626 L3_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00474 RIBOSOMAL_L3, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P20279-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPQPSRPRKG SLGFGPRKRS TSETPRFNSW PSDDGQPGVQ GFAGYKAGMT 
        60         70         80         90        100
HVVLVNDEPN SPREGMEETV PVTVIETPPM RAVALRAYED TPYGQRPLTE 
       110        120        130        140        150
VWTDEFHSEL DRTLDVPEDH DPDAAEEQIR DAHEAGDLGD LRLITHTVPD 
       160        170        180        190        200
AVPSVPKKKP DVMETRVGGG SVSDRLDHAL DIVEDGGEHA MNDIFRAGEY 
       210        220        230        240        250
ADVAGVTKGK GTQGPVKRWG VQKRKGKHAR QGWRRRIGNL GPWNPSRVRS 
       260        270        280        290        300
TVPQQGQTGY HQRTELNKRL IDIGEGDEPT VDGGFVNYGE VDGPYTLVKG 
       310        320        330 
SVPGPDKRLV RFRPAVRPND QPRLDPEVRY VSNESNQG

Length:338

Mass (Da):37,341

Last modified:January 23, 2007 - v5

Checksum:ⁱ996D3BE503F4DBD4

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	311	R → P in AAA86859 (PubMed:2406244).Curated		1
Sequence conflictⁱ	312	F → FF AA sequence (PubMed:2406244).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J05222 Genomic DNA Translation: AAA86859.1 AY596297 Genomic DNA Translation: AAV46528.1
PIRⁱ	C35063 R5HS3L
NCBI Reference Sequences More...RefSeqⁱ	WP_004957423.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46528; AAV46528; rrnAC1611
GeneIDⁱ	3128366
KEGGⁱ	hma:rrnAC1611
PATRICⁱ	fig\|272569.17.peg.2301

Protein	Similar proteins		Species	Score	Length	Source
P20279	50S ribosomal protein L3		HALHT		338	UniRef100_P20279
50S ribosomal protein L3		Haloarcula hispanica N601		338
50S ribosomal protein L3		Haloarcula sinaiiensis ATCC 33800		338
50S ribosomal protein L3		Haloarcula sp. CBA1115		338
UPI00001120CF		Haloarcula marismortui		337

Protein	Similar proteins		Species	Score	Length	Source
P20279	50S ribosomal protein L3		HALHT		338	UniRef90_P20279
50S ribosomal protein L3		Haloarcula hispanica N601		338
50S ribosomal protein L3		Haloarcula sinaiiensis ATCC 33800		338
50S ribosomal protein L3		Haloarcula sp. CBA1115		338
50S ribosomal protein L3		Halobacteriales archaeon QS_6_64_34		338
+14

Protein	Similar proteins		Species	Score	Length	Source
P20279	50S ribosomal protein L3		METAR		337	UniRef50_P20279
50S ribosomal protein L3		METS3		336
50S ribosomal protein L3		METMA		337
50S ribosomal protein L3		METAC		337
50S ribosomal protein L3		ARCFU		331
+563

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J05222 Genomic DNA Translation: AAA86859.1 AY596297 Genomic DNA Translation: AAV46528.1
PIRⁱ	C35063 R5HS3L
RefSeqⁱ	WP_004957423.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	B	2-338	[»]
	1JJ2	X-ray	2.40	B	2-338	[»]
	1K73	X-ray	3.01	D	2-338	[»]
	1K8A	X-ray	3.00	D	2-338	[»]
	1K9M	X-ray	3.00	D	2-338	[»]
	1KC8	X-ray	3.01	D	2-338	[»]
	1KD1	X-ray	3.00	D	2-338	[»]
	1KQS	X-ray	3.10	B	2-338	[»]
	1M1K	X-ray	3.20	D	2-338	[»]
	1M90	X-ray	2.80	D	2-338	[»]
	1ML5	electron microscopy	14.00	e	2-311	[»]
				e	312-338	[»]
	1N8R	X-ray	3.00	D	2-338	[»]
	1NJI	X-ray	3.00	D	2-338	[»]
	1Q7Y	X-ray	3.20	D	2-338	[»]
	1Q81	X-ray	2.95	D	2-338	[»]
	1Q82	X-ray	2.98	D	2-338	[»]
	1Q86	X-ray	3.00	D	2-338	[»]
	1QVF	X-ray	3.10	B	2-338	[»]
	1QVG	X-ray	2.90	B	2-338	[»]
	1S72	X-ray	2.40	B	1-338	[»]
	1VQ4	X-ray	2.70	B	1-338	[»]
	1VQ5	X-ray	2.60	B	1-338	[»]
	1VQ6	X-ray	2.70	B	1-338	[»]
	1VQ7	X-ray	2.50	B	1-338	[»]
	1VQ8	X-ray	2.20	B	1-338	[»]
	1VQ9	X-ray	2.40	B	1-338	[»]
	1VQK	X-ray	2.30	B	1-338	[»]
	1VQL	X-ray	2.30	B	1-338	[»]
	1VQM	X-ray	2.30	B	1-338	[»]
	1VQN	X-ray	2.40	B	1-338	[»]
	1VQO	X-ray	2.20	B	1-338	[»]
	1VQP	X-ray	2.25	B	1-338	[»]
	1W2B	X-ray	3.50	B	2-338	[»]
	1YHQ	X-ray	2.40	B	1-338	[»]
	1YI2	X-ray	2.65	B	1-338	[»]
	1YIJ	X-ray	2.60	B	1-338	[»]
	1YIT	X-ray	2.80	B	1-338	[»]
	1YJ9	X-ray	2.90	B	1-338	[»]
	1YJN	X-ray	3.00	B	1-338	[»]
	1YJW	X-ray	2.90	B	1-338	[»]
	2OTJ	X-ray	2.90	B	1-338	[»]
	2OTL	X-ray	2.70	B	2-338	[»]
	2QA4	X-ray	3.00	B	1-338	[»]
	2QEX	X-ray	2.90	B	1-338	[»]
	3CC2	X-ray	2.40	B	1-338	[»]
	3CC4	X-ray	2.70	B	1-338	[»]
	3CC7	X-ray	2.70	B	1-338	[»]
	3CCE	X-ray	2.75	B	1-338	[»]
	3CCJ	X-ray	2.70	B	1-338	[»]
	3CCL	X-ray	2.90	B	1-338	[»]
	3CCM	X-ray	2.55	B	1-338	[»]
	3CCQ	X-ray	2.90	B	1-338	[»]
	3CCR	X-ray	3.00	B	1-338	[»]
	3CCS	X-ray	2.95	B	1-338	[»]
	3CCU	X-ray	2.80	B	1-338	[»]
	3CCV	X-ray	2.90	B	1-338	[»]
	3CD6	X-ray	2.75	B	1-338	[»]
	3CMA	X-ray	2.80	B	1-338	[»]
	3CME	X-ray	2.95	B	1-338	[»]
	3CPW	X-ray	2.70	B	1-338	[»]
	3CXC	X-ray	3.00	B	2-338	[»]
	3G4S	X-ray	3.20	B	2-338	[»]
3G6E	X-ray	2.70	B	2-338	[»]
3G71	X-ray	2.85	B	2-338	[»]
3I55	X-ray	3.11	B	1-338	[»]
3I56	X-ray	2.90	B	1-338	[»]
3OW2	X-ray	2.70	B	2-338	[»]
4ADX	electron microscopy	6.60	B	1-338	[»]
4V4T	X-ray	6.46	E	2-338	[»]
4V9F	X-ray	2.40	B	1-338	[»]
ProteinModelPortalⁱ	P20279
SMRⁱ	P20279
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1611

STRINGⁱ

272569.rrnAC1611

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46528; AAV46528; rrnAC1611
GeneIDⁱ	3128366
KEGGⁱ	hma:rrnAC1611
PATRICⁱ	fig\|272569.17.peg.2301

Phylogenomic databases

eggNOGⁱ	arCOG04070 Archaea COG0087 LUCA
HOGENOMⁱ	HOG000107320
KOⁱ	K02906
OMAⁱ	HQRTEYN
OrthoDBⁱ	POG093Z05KT

Miscellaneous databases

EvolutionaryTraceⁱ	P20279

EvolutionaryTraceⁱ

P20279

Family and domain databases

HAMAPⁱ	MF_01325_A Ribosomal_L3_A, 1 hit
InterProⁱ	View protein in InterPro IPR000597 Ribosomal_L3 IPR019928 Ribosomal_L3_arc IPR019926 Ribosomal_L3_CS IPR009000 Transl_B-barrel_sf
PANTHERⁱ	PTHR11363:SF5 PTHR11363:SF5, 1 hit
Pfamⁱ	View protein in Pfam PF00297 Ribosomal_L3, 1 hit
SUPFAMⁱ	SSF50447 SSF50447, 1 hit
TIGRFAMsⁱ	TIGR03626 L3_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00474 RIBOSOMAL_L3, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL3_HALMA
Accessionⁱ	P20279Primary (citable) accession number: P20279 Secondary accession number(s): Q5V1S4
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1991
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 128 of the entry and version 5 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P20279 (RL3_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L3

rpl3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ