Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kallikrein-2

Gene

KLK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Catalytic activityi

Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei65Charge relay system1
Active sitei120Charge relay system1
Active sitei213Charge relay system1

GO - Molecular functioni

  • serine-type endopeptidase activity Source: BHF-UCL

GO - Biological processi

  • extracellular matrix disassembly Source: Reactome
  • regulation of systemic arterial blood pressure Source: GO_Central
  • zymogen activation Source: GO_Central

Keywordsi

Molecular functionHydrolase, Protease, Serine protease

Enzyme and pathway databases

ReactomeiR-HSA-1592389 Activation of Matrix Metalloproteinases
R-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-5625886 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
SIGNORiP20151

Protein family/group databases

MEROPSiS01.161

Names & Taxonomyi

Protein namesi
Recommended name:
Kallikrein-2 (EC:3.4.21.35)
Alternative name(s):
Glandular kallikrein-1
Short name:
hGK-1
Tissue kallikrein-2
Gene namesi
Name:KLK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000167751.12
HGNCiHGNC:6363 KLK2
MIMi147960 gene
neXtProtiNX_P20151

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi3817
OpenTargetsiENSG00000167751
PharmGKBiPA30152

Protein family/group databases

Allergomei2836 Hom s PSA

Chemistry databases

ChEMBLiCHEMBL2442
GuidetoPHARMACOLOGYi2372

Polymorphism and mutation databases

BioMutaiKLK2
DMDMi125174

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18CuratedAdd BLAST18
PropeptideiPRO_000002792919 – 24Activation peptideCurated6
ChainiPRO_000002793025 – 261Kallikrein-2Add BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi31 ↔ 173PROSITE-ProRule annotation
Disulfide bondi50 ↔ 66PROSITE-ProRule annotation
Glycosylationi102N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi152 ↔ 219PROSITE-ProRule annotation
Disulfide bondi184 ↔ 198PROSITE-ProRule annotation
Disulfide bondi209 ↔ 234PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

MaxQBiP20151
PaxDbiP20151
PeptideAtlasiP20151
PRIDEiP20151
ProteomicsDBi53728
53729 [P20151-2]
53730 [P20151-3]

PTM databases

iPTMnetiP20151
PhosphoSitePlusiP20151

Miscellaneous databases

PMAP-CutDBiP20151

Expressioni

Gene expression databases

BgeeiENSG00000167751 Expressed in 117 organ(s), highest expression level in prostate gland
CleanExiHS_KLK2
ExpressionAtlasiP20151 baseline and differential
GenevisibleiP20151 HS

Organism-specific databases

HPAiHPA000764

Interactioni

Protein-protein interaction databases

BioGridi110017, 11 interactors
STRINGi9606.ENSP00000313581

Chemistry databases

BindingDBiP20151

Structurei

Secondary structure

1261
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP20151
SMRiP20151
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 258Peptidase S1PROSITE-ProRule annotationAdd BLAST234

Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00930000150914
HOGENOMiHOG000251820
HOVERGENiHBG013304
InParanoidiP20151
KOiK01325
OMAiIGGWECE
OrthoDBiEOG091G0DF7
PhylomeDBiP20151
TreeFamiTF331065

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P20151-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWDLVLSIAL SVGCTGAVPL IQSRIVGGWE CEKHSQPWQV AVYSHGWAHC
60 70 80 90 100
GGVLVHPQWV LTAAHCLKKN SQVWLGRHNL FEPEDTGQRV PVSHSFPHPL
110 120 130 140 150
YNMSLLKHQS LRPDEDSSHD LMLLRLSEPA KITDVVKVLG LPTQEPALGT
160 170 180 190 200
TCYASGWGSI EPEEFLRPRS LQCVSLHLLS NDMCARAYSE KVTEFMLCAG
210 220 230 240 250
LWTGGKDTCG GDSGGPLVCN GVLQGITSWG PEPCALPEKP AVYTKVVHYR
260
KWIKDTIAAN P
Length:261
Mass (Da):28,671
Last modified:February 1, 1991 - v1
Checksum:i9CF7F4A1162EF42D
GO
Isoform 2 (identifier: P20151-2) [UniParc]FASTAAdd to basket
Also known as: PGK-10A

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP → VSHPYSQHLEGKG

Show »
Length:223
Mass (Da):24,674
Checksum:i051F76900C2AFEA9
GO
Isoform 3 (identifier: P20151-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-261: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:164
Mass (Da):18,162
Checksum:i00D2AE5561DB788E
GO
Isoform 4 (identifier: P20151-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.

Note: No experimental confirmation available.
Show »
Length:159
Mass (Da):17,301
Checksum:iB978EFD702D36903
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R1T3M0R1T3_HUMAN
Kallikrein-2
KLK2
69Annotation score:
M0QXQ7M0QXQ7_HUMAN
Kallikrein-2
KLK2
122Annotation score:
Q6T774Q6T774_HUMAN
Kallikrein 2 isoform 6 preproprotei...
KLK2
49Annotation score:
A0A075B7A6A0A075B7A6_HUMAN
Kallikrein-2
KLK2
184Annotation score:
M0R0M4M0R0M4_HUMAN
Kallikrein-2
KLK2
43Annotation score:
M0R0M2M0R0M2_HUMAN
Kallikrein-2
KLK2
51Annotation score:
M0R2W5M0R2W5_HUMAN
Kallikrein-2
KLK2
22Annotation score:

Sequence cautioni

The sequence AAD13817 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti143T → A in BAG62255 (PubMed:14702039).Curated1
Isoform 2 (identifier: P20151-2)
Sequence conflicti223G → GE in BAG62272 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01416418V → L1 PublicationCorresponds to variant dbSNP:rs6072Ensembl.1
Natural variantiVAR_020178250R → W. Corresponds to variant dbSNP:rs198977Ensembl.1
Natural variantiVAR_061775255D → A. Corresponds to variant dbSNP:rs60268688Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447091 – 102Missing in isoform 4. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_005400165 – 261Missing in isoform 3. CuratedAdd BLAST97
Alternative sequenceiVSP_005399211 – 261GDSGG…IAANP → VSHPYSQHLEGKG in isoform 2. 2 PublicationsAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M18156 Genomic DNA No translation available.
M18157 Genomic DNA Translation: AAA74454.1
S39329 mRNA Translation: AAD13816.1
S39329 mRNA Translation: AAD13817.1 Sequence problems.
AF188745 mRNA Translation: AAF08275.1
AF188746 mRNA Translation: AAF08276.1
AF188747 mRNA Translation: AAF08277.1
AF243527 Genomic DNA Translation: AAG33356.1
BT006650 mRNA Translation: AAP35296.1
AK300549 mRNA Translation: BAG62255.1
AK300566 mRNA Translation: BAG62272.1
AC037199 Genomic DNA No translation available.
BC005196 mRNA Translation: AAH05196.1
CCDSiCCDS12808.1 [P20151-1]
CCDS42597.1 [P20151-2]
CCDS58675.1 [P20151-4]
PIRiA29586
RefSeqiNP_001002231.1, NM_001002231.2 [P20151-2]
NP_001243009.1, NM_001256080.1 [P20151-4]
NP_005542.1, NM_005551.4 [P20151-1]
UniGeneiHs.515560

Genome annotation databases

EnsembliENST00000325321; ENSP00000313581; ENSG00000167751 [P20151-1]
ENST00000358049; ENSP00000350748; ENSG00000167751 [P20151-2]
ENST00000391810; ENSP00000375686; ENSG00000167751 [P20151-4]
ENST00000597439; ENSP00000471214; ENSG00000167751 [P20151-3]
GeneIDi3817
KEGGihsa:3817
UCSCiuc002ptu.4 human [P20151-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M18156 Genomic DNA No translation available.
M18157 Genomic DNA Translation: AAA74454.1
S39329 mRNA Translation: AAD13816.1
S39329 mRNA Translation: AAD13817.1 Sequence problems.
AF188745 mRNA Translation: AAF08275.1
AF188746 mRNA Translation: AAF08276.1
AF188747 mRNA Translation: AAF08277.1
AF243527 Genomic DNA Translation: AAG33356.1
BT006650 mRNA Translation: AAP35296.1
AK300549 mRNA Translation: BAG62255.1
AK300566 mRNA Translation: BAG62272.1
AC037199 Genomic DNA No translation available.
BC005196 mRNA Translation: AAH05196.1
CCDSiCCDS12808.1 [P20151-1]
CCDS42597.1 [P20151-2]
CCDS58675.1 [P20151-4]
PIRiA29586
RefSeqiNP_001002231.1, NM_001002231.2 [P20151-2]
NP_001243009.1, NM_001256080.1 [P20151-4]
NP_005542.1, NM_005551.4 [P20151-1]
UniGeneiHs.515560

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NFEX-ray1.90A25-261[»]
4NFFX-ray1.90A25-261[»]
ProteinModelPortaliP20151
SMRiP20151
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110017, 11 interactors
STRINGi9606.ENSP00000313581

Chemistry databases

BindingDBiP20151
ChEMBLiCHEMBL2442
GuidetoPHARMACOLOGYi2372

Protein family/group databases

Allergomei2836 Hom s PSA
MEROPSiS01.161

PTM databases

iPTMnetiP20151
PhosphoSitePlusiP20151

Polymorphism and mutation databases

BioMutaiKLK2
DMDMi125174

Proteomic databases

MaxQBiP20151
PaxDbiP20151
PeptideAtlasiP20151
PRIDEiP20151
ProteomicsDBi53728
53729 [P20151-2]
53730 [P20151-3]

Protocols and materials databases

DNASUi3817
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325321; ENSP00000313581; ENSG00000167751 [P20151-1]
ENST00000358049; ENSP00000350748; ENSG00000167751 [P20151-2]
ENST00000391810; ENSP00000375686; ENSG00000167751 [P20151-4]
ENST00000597439; ENSP00000471214; ENSG00000167751 [P20151-3]
GeneIDi3817
KEGGihsa:3817
UCSCiuc002ptu.4 human [P20151-1]

Organism-specific databases

CTDi3817
DisGeNETi3817
EuPathDBiHostDB:ENSG00000167751.12
GeneCardsiKLK2
HGNCiHGNC:6363 KLK2
HPAiHPA000764
MIMi147960 gene
neXtProtiNX_P20151
OpenTargetsiENSG00000167751
PharmGKBiPA30152
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00930000150914
HOGENOMiHOG000251820
HOVERGENiHBG013304
InParanoidiP20151
KOiK01325
OMAiIGGWECE
OrthoDBiEOG091G0DF7
PhylomeDBiP20151
TreeFamiTF331065

Enzyme and pathway databases

ReactomeiR-HSA-1592389 Activation of Matrix Metalloproteinases
R-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-5625886 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
SIGNORiP20151

Miscellaneous databases

ChiTaRSiKLK2 human
GenomeRNAii3817
PMAP-CutDBiP20151
PROiPR:P20151
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167751 Expressed in 117 organ(s), highest expression level in prostate gland
CleanExiHS_KLK2
ExpressionAtlasiP20151 baseline and differential
GenevisibleiP20151 HS

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKLK2_HUMAN
AccessioniPrimary (citable) accession number: P20151
Secondary accession number(s): B4DU93
, B4DUB0, F5H8L3, Q15946, Q9UJZ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: November 7, 2018
This is version 178 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again