Id1

Functionⁱ

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.2 Publications

GO - Molecular functionⁱ

DNA-binding transcription factor activity
Source: UniProtKB
Inferred from direct assayⁱ
- 17681138
proteasome binding Source: MGI
protein C-terminus binding Source: MGI
protein homodimerization activity Source: MGI
protein N-terminus binding Source: MGI
protein self-association
Source: MGI
Inferred from direct assayⁱ
- 20231428
RNA polymerase II transcription factor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
transcription factor binding Source: MGI

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

BMP signaling pathway
Source: MGI
Inferred from direct assayⁱ
- 15820682
brain development Source: Ensembl
cell-abiotic substrate adhesion Source: Ensembl
cellular response to dopamine Source: Ensembl
cellular response to epidermal growth factor stimulus Source: Ensembl
cellular response to nerve growth factor stimulus Source: Ensembl
cellular response to peptide Source: Ensembl
cellular response to transforming growth factor beta stimulus Source: Ensembl
circadian rhythm
Source: UniProtKB
Inferred from expression patternⁱ
- 19217292
collagen metabolic process
Source: MGI
Inferred from mutant phenotypeⁱ
- 17717145
endothelial cell morphogenesis
Source: MGI
Inferred from mutant phenotypeⁱ
- 17717145
heart development
Source: MGI
Inferred from genetic interactionⁱ
- 15472070
lung morphogenesis
Source: MGI
Inferred from mutant phenotypeⁱ
- 17717145
lung vasculature development
Source: MGI
Inferred from mutant phenotypeⁱ
- 17717145
negative regulation of apoptotic process
Source: MGI
Inferred from mutant phenotypeⁱ
- 17717145
negative regulation of cold-induced thermogenesis
Source: YuBioLab
Inferred from mutant phenotypeⁱ
- 28270523
negative regulation of dendrite morphogenesis Source: MGI
negative regulation of DNA binding
Source: MGI
Inferred from direct assayⁱ
- 1922066
negative regulation of DNA-binding transcription factor activity Source: MGI
negative regulation of endothelial cell differentiation Source: MGI
negative regulation of gene expression
Source: MGI
Inferred from mutant phenotypeⁱ
- 20231428
negative regulation of neuron differentiation
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
negative regulation of osteoblast differentiation
Source: MGI
Inferred from genetic interactionⁱ
- 15161906
negative regulation of protein binding Source: MGI
negative regulation of protein homodimerization activity
Source: MGI
Inferred from direct assayⁱ
- 20231428
negative regulation of transcription, DNA-templated
Source: UniProtKB
Inferred from direct assayⁱ
- 19217292
negative regulation of transcription by RNA polymerase II
Source: MGI
Inferred from direct assayⁱ
- 12498716
neuron differentiation
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
positive regulation of actin filament bundle assembly Source: MGI
positive regulation of epithelial cell proliferation Source: MGI
positive regulation of gene expression Source: MGI
protein destabilization
Source: MGI
Inferred from direct assayⁱ
- 15322112
regulation of angiogenesis
Source: MGI
Inferred from mutant phenotypeⁱ
- 12498716
regulation of cell cycle
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
regulation of MAPK cascade
Source: MGI
Inferred from mutant phenotypeⁱ
- 17717145
regulation of vasculature development Source: MGI
response to antibiotic
Source: MGI
Inferred from mutant phenotypeⁱ
- 17717145
transcription, DNA-templated
Source: UniProtKB
Inferred from direct assayⁱ
- 17681138

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Developmental protein, Repressor
Biological process	Biological rhythms, Transcription, Transcription regulation

Enzyme and pathway databases

Reactomeⁱ	R-MMU-2559585 Oncogene Induced Senescence

Reactomeⁱ

R-MMU-2559585 Oncogene Induced Senescence

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: DNA-binding protein inhibitor ID-1 Alternative name(s): Inhibitor of DNA binding 1 Inhibitor of differentiation 1
Gene namesⁱ	Name:Id1 Synonyms:Id, Id-1, Idb1
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 2

Organism-specific databases

MGIⁱ	MGI:96396 Id1

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000127237	1 – 168	DNA-binding protein inhibitor ID-1Add BLAST		168

Post-translational modificationⁱ

Polyubiquitinated; which is favored by Ifi204 and leads to proteasomal degradation.By similarity

Keywords - PTMⁱ

Ubl conjugation

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P20067
PaxDbⁱ	P20067
PRIDEⁱ	P20067

PTM databases

iPTMnetⁱ	P20067
PhosphoSitePlusⁱ	P20067

Expressionⁱ

Inductionⁱ

Expressed in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain and heart with peak levels seen between CT16 and CT20 in the SCN and between CT8 and CT12 in the heart.1 Publication

Gene expression databases

Bgeeⁱ	ENSMUSG00000042745 Expressed in 345 organ(s), highest expression level in mucous cell of stomach
CleanExⁱ	MM_ID1
ExpressionAtlasⁱ	P20067 baseline and differential
Genevisibleⁱ	P20067 MM

Interactionⁱ

Subunit structureⁱ

Heterodimer with other HLH proteins. Interacts with CLOCK and ARNTL/BMAL1 (By similarity). Interacts with COPS5, IFI204, GATA4 and NKX2-5.By similarity3 Publications

GO - Molecular functionⁱ

protein C-terminus binding Source: MGI
protein homodimerization activity Source: MGI
protein N-terminus binding Source: MGI
protein self-association
Source: MGI
Inferred from direct assayⁱ
- 20231428
RNA polymerase II transcription factor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
transcription factor binding Source: MGI

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

IntActⁱ	P20067, 3 interactors
Molecular INTeraction database More...MINTⁱ	P20067
STRINGⁱ	10090.ENSMUSP00000092019

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P20067
SMRⁱ	P20067
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	46 – 98	bHLHPROSITE-ProRule annotationAdd BLAST		53

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	53 – 106	Interaction with IFI204By similarityAdd BLAST		54

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	91 – 104	Nuclear export signalAdd BLAST		14

Phylogenomic databases

eggNOGⁱ	ENOG410IWDR Eukaryota ENOG4111VAY LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000000908
HOGENOMⁱ	HOG000234788
HOVERGENⁱ	HBG009009
InParanoidⁱ	P20067
OMAⁱ	EQPVNVL
PhylomeDBⁱ	P20067
TreeFamⁱ	TF326217

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00083 HLH, 1 hit
Gene3Dⁱ	4.10.280.10, 1 hit
InterProⁱ	View protein in InterPro IPR011598 bHLH_dom IPR026052 DNA-bd_prot-inh IPR036638 HLH_DNA-bd_sf
PANTHERⁱ	PTHR11723 PTHR11723, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00010 HLH, 1 hit
SMARTⁱ	View protein in SMART SM00353 HLH, 1 hit
SUPFAMⁱ	SSF47459 SSF47459, 1 hit
PROSITEⁱ	View protein in PROSITE PS50888 BHLH, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

Note: Additional isoforms seem to exist.

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show all Align All

Isoform Long (identifier: P20067-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKVASGSAAA AAGPSCSLKA GRTAGEVVLG LSEQSVAISR CAGTRLPALL 
        60         70         80         90        100
DEQQVNVLLY DMNGCYSRLK ELVPTLPQNR KVSKVEILQH VIDYIRDLQL 
       110        120        130        140        150
ELNSESEVGT TGGRGLPVRA PLSTLNGEIS ALAAEVRSES EYYIILQWET 
       160 
EATGGGCPPS LLFRRIAI

Length:168

Mass (Da):17,914

Last modified:November 1, 1997 - v3

Checksum:ⁱ7F7EF0177358F516

GO

Isoform Short (identifier: P20067-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
136-168: VRSESEYYIILQWETEATGGGCPPSLLFRRIAI → AACVPADDRILCR

« Hide

        10         20         30         40         50
MKVASGSAAA AAGPSCSLKA GRTAGEVVLG LSEQSVAISR CAGTRLPALL 
        60         70         80         90        100
DEQQVNVLLY DMNGCYSRLK ELVPTLPQNR KVSKVEILQH VIDYIRDLQL 
       110        120        130        140 
ELNSESEVGT TGGRGLPVRA PLSTLNGEIS ALAAEAACVP ADDRILCR

Show »

Length:148

Mass (Da):15,560

Checksum:ⁱE12DAC2DA361E3B2

GO

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	A2AHY3	A2AHY3_MOUSE		DNA-binding protein inhibitor ID-1 DNA-binding protein inhibitor ID-1	Id1	168	Annotation score:

Sequence cautionⁱ

The sequence AAA37879 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	140	S → A in BAB25564 (PubMed:16141072).Curated		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_002109	136 – 168	VRSES…RRIAI → AACVPADDRILCR in isoform Short. 1 PublicationAdd BLAST		33

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M31885 mRNA Translation: AAA37879.1 Different initiation. U43884 mRNA Translation: AAC52760.1 AK008264 mRNA Translation: BAB25564.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS16897.1 [P20067-2]
PIRⁱ	A34690 S72171
UniGeneⁱ	Mm.444

Genome annotation databases

Ensemblⁱ	ENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745 [P20067-2]

Ensemblⁱ

ENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745 [P20067-2]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P20067	DNA-binding protein inhibitor ID-1		RAT		164	UniRef90_P20067
DNA-binding protein inhibitor ID-1		MOUSE		168
UPI00001EE2C9		MOUSE		154
P20067-2	Isoform ID-B of DNA-binding protein inhibitor ID-1		HUMAN		149	UniRef90_P41134-2
ID1 isoform 2		PANTR		149
Uncharacterized protein		PAPAN		163
DNA-binding protein inhibitor ID-1 isoform a		MACMU		154
Uncharacterized protein		CERAT		154
+41

Protein	Similar proteins		Species	Score	Length	Source
P20067	DNA-binding protein inhibitor ID-1		RAT		164	UniRef50_P20067
DNA-binding protein inhibitor ID-1		HUMAN		155
DNA-binding protein inhibitor ID-1		MOUSE		168
Inhibitor of DNA binding 1		MACFA		154
Inhibitor of DNA binding 1, dominant negative helix-loop-helix protein		PANTR		155
+116

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M31885 mRNA Translation: AAA37879.1 Different initiation. U43884 mRNA Translation: AAC52760.1 AK008264 mRNA Translation: BAB25564.1
CCDSⁱ	CCDS16897.1 [P20067-2]
PIRⁱ	A34690 S72171
UniGeneⁱ	Mm.444

3D structure databases

ProteinModelPortalⁱ	P20067
SMRⁱ	P20067
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

IntActⁱ	P20067, 3 interactors
MINTⁱ	P20067
STRINGⁱ	10090.ENSMUSP00000092019

PTM databases

iPTMnetⁱ	P20067
PhosphoSitePlusⁱ	P20067

Proteomic databases

MaxQBⁱ	P20067
PaxDbⁱ	P20067
PRIDEⁱ	P20067

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745 [P20067-2]

Ensemblⁱ

ENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745 [P20067-2]

Organism-specific databases

MGIⁱ	MGI:96396 Id1

Phylogenomic databases

eggNOGⁱ	ENOG410IWDR Eukaryota ENOG4111VAY LUCA
GeneTreeⁱ	ENSGT00390000000908
HOGENOMⁱ	HOG000234788
HOVERGENⁱ	HBG009009
InParanoidⁱ	P20067
OMAⁱ	EQPVNVL
PhylomeDBⁱ	P20067
TreeFamⁱ	TF326217

Enzyme and pathway databases

Reactomeⁱ	R-MMU-2559585 Oncogene Induced Senescence

Reactomeⁱ

R-MMU-2559585 Oncogene Induced Senescence

Miscellaneous databases

Protein Ontology More...PROⁱ	PR:P20067
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000042745 Expressed in 345 organ(s), highest expression level in mucous cell of stomach
CleanExⁱ	MM_ID1
ExpressionAtlasⁱ	P20067 baseline and differential
Genevisibleⁱ	P20067 MM

Family and domain databases

CDDⁱ	cd00083 HLH, 1 hit
Gene3Dⁱ	4.10.280.10, 1 hit
InterProⁱ	View protein in InterPro IPR011598 bHLH_dom IPR026052 DNA-bd_prot-inh IPR036638 HLH_DNA-bd_sf
PANTHERⁱ	PTHR11723 PTHR11723, 1 hit
Pfamⁱ	View protein in Pfam PF00010 HLH, 1 hit
SMARTⁱ	View protein in SMART SM00353 HLH, 1 hit
SUPFAMⁱ	SSF47459 SSF47459, 1 hit
PROSITEⁱ	View protein in PROSITE PS50888 BHLH, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	ID1_MOUSE
Accessionⁱ	P20067Primary (citable) accession number: P20067 Secondary accession number(s): Q61101, Q9D897
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1991
	Last sequence update:	November 1, 1997
	Last modified:	November 7, 2018
	This is version 164 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P20067 (ID1_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

DNA-binding protein inhibitor ID-1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Cytoskeleton

Golgi apparatus

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Motif

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ