Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-binding protein inhibitor ID-1

Gene

Id1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Repressor
Biological processBiological rhythms, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-2559585 Oncogene Induced Senescence

Names & Taxonomyi

Protein namesi
Recommended name:
DNA-binding protein inhibitor ID-1
Alternative name(s):
Inhibitor of DNA binding 1
Inhibitor of differentiation 1
Gene namesi
Name:Id1
Synonyms:Id, Id-1, Idb1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:96396 Id1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001272371 – 168DNA-binding protein inhibitor ID-1Add BLAST168

Post-translational modificationi

Polyubiquitinated; which is favored by Ifi204 and leads to proteasomal degradation.By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiP20067
PaxDbiP20067
PRIDEiP20067

PTM databases

iPTMnetiP20067
PhosphoSitePlusiP20067

Expressioni

Inductioni

Expressed in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain and heart with peak levels seen between CT16 and CT20 in the SCN and between CT8 and CT12 in the heart.1 Publication

Gene expression databases

BgeeiENSMUSG00000042745 Expressed in 345 organ(s), highest expression level in mucous cell of stomach
CleanExiMM_ID1
ExpressionAtlasiP20067 baseline and differential
GenevisibleiP20067 MM

Interactioni

Subunit structurei

Heterodimer with other HLH proteins. Interacts with CLOCK and ARNTL/BMAL1 (By similarity). Interacts with COPS5, IFI204, GATA4 and NKX2-5.By similarity3 Publications

GO - Molecular functioni

Protein-protein interaction databases

IntActiP20067, 3 interactors
MINTiP20067
STRINGi10090.ENSMUSP00000092019

Structurei

3D structure databases

ProteinModelPortaliP20067
SMRiP20067
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini46 – 98bHLHPROSITE-ProRule annotationAdd BLAST53

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni53 – 106Interaction with IFI204By similarityAdd BLAST54

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi91 – 104Nuclear export signalAdd BLAST14

Phylogenomic databases

eggNOGiENOG410IWDR Eukaryota
ENOG4111VAY LUCA
GeneTreeiENSGT00390000000908
HOGENOMiHOG000234788
HOVERGENiHBG009009
InParanoidiP20067
PhylomeDBiP20067
TreeFamiTF326217

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR026052 DNA-bd_prot-inh
IPR036638 HLH_DNA-bd_sf
PANTHERiPTHR11723 PTHR11723, 1 hit
PfamiView protein in Pfam
PF00010 HLH, 1 hit
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform Long (identifier: P20067-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKVASGSAAA AAGPSCSLKA GRTAGEVVLG LSEQSVAISR CAGTRLPALL
60 70 80 90 100
DEQQVNVLLY DMNGCYSRLK ELVPTLPQNR KVSKVEILQH VIDYIRDLQL
110 120 130 140 150
ELNSESEVGT TGGRGLPVRA PLSTLNGEIS ALAAEVRSES EYYIILQWET
160
EATGGGCPPS LLFRRIAI
Length:168
Mass (Da):17,914
Last modified:November 1, 1997 - v3
Checksum:i7F7EF0177358F516
GO
Isoform Short (identifier: P20067-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-168: VRSESEYYIILQWETEATGGGCPPSLLFRRIAI → AACVPADDRILCR

Show »
Length:148
Mass (Da):15,560
Checksum:iE12DAC2DA361E3B2
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AHY3A2AHY3_MOUSE
DNA-binding protein inhibitor ID-1
Id1
168Annotation score:

Sequence cautioni

The sequence AAA37879 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti140S → A in BAB25564 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002109136 – 168VRSES…RRIAI → AACVPADDRILCR in isoform Short. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31885 mRNA Translation: AAA37879.1 Different initiation.
U43884 mRNA Translation: AAC52760.1
AK008264 mRNA Translation: BAB25564.1
CCDSiCCDS16897.1 [P20067-2]
PIRiA34690
S72171
UniGeneiMm.444

Genome annotation databases

EnsembliENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745 [P20067-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31885 mRNA Translation: AAA37879.1 Different initiation.
U43884 mRNA Translation: AAC52760.1
AK008264 mRNA Translation: BAB25564.1
CCDSiCCDS16897.1 [P20067-2]
PIRiA34690
S72171
UniGeneiMm.444

3D structure databases

ProteinModelPortaliP20067
SMRiP20067
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP20067, 3 interactors
MINTiP20067
STRINGi10090.ENSMUSP00000092019

PTM databases

iPTMnetiP20067
PhosphoSitePlusiP20067

Proteomic databases

MaxQBiP20067
PaxDbiP20067
PRIDEiP20067

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745 [P20067-2]

Organism-specific databases

MGIiMGI:96396 Id1

Phylogenomic databases

eggNOGiENOG410IWDR Eukaryota
ENOG4111VAY LUCA
GeneTreeiENSGT00390000000908
HOGENOMiHOG000234788
HOVERGENiHBG009009
InParanoidiP20067
PhylomeDBiP20067
TreeFamiTF326217

Enzyme and pathway databases

ReactomeiR-MMU-2559585 Oncogene Induced Senescence

Miscellaneous databases

PROiPR:P20067
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000042745 Expressed in 345 organ(s), highest expression level in mucous cell of stomach
CleanExiMM_ID1
ExpressionAtlasiP20067 baseline and differential
GenevisibleiP20067 MM

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR026052 DNA-bd_prot-inh
IPR036638 HLH_DNA-bd_sf
PANTHERiPTHR11723 PTHR11723, 1 hit
PfamiView protein in Pfam
PF00010 HLH, 1 hit
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiID1_MOUSE
AccessioniPrimary (citable) accession number: P20067
Secondary accession number(s): Q61101, Q9D897
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: November 1, 1997
Last modified: September 12, 2018
This is version 163 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again