Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plasma membrane calcium-transporting ATPase 1

Gene

ATP2B1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei4754-aspartylphosphate intermediate1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi797MagnesiumBy similarity1
Metal bindingi801MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Hydrolase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.6.3.8 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418359 Reduction of cytosolic Ca++ levels
R-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Protein family/group databases

Transport Classification Database

More...
TCDBi
3.A.3.2.25 the p-type atpase (p-atpase) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 1 (EC:3.6.3.8)
Short name:
PMCA1
Alternative name(s):
Plasma membrane calcium ATPase isoform 1
Plasma membrane calcium pump isoform 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATP2B1
Synonyms:PMCA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000070961.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:814 ATP2B1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
108731 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P20020

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 97CytoplasmicSequence analysisAdd BLAST96
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei98 – 118HelicalSequence analysisAdd BLAST21
Topological domaini119 – 154ExtracellularSequence analysisAdd BLAST36
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 366CytoplasmicSequence analysisAdd BLAST191
Transmembranei367 – 386HelicalSequence analysisAdd BLAST20
Topological domaini387 – 419ExtracellularSequence analysisAdd BLAST33
Transmembranei420 – 437HelicalSequence analysisAdd BLAST18
Topological domaini438 – 852CytoplasmicSequence analysisAdd BLAST415
Transmembranei853 – 872HelicalSequence analysisAdd BLAST20
Topological domaini873 – 882ExtracellularSequence analysis10
Transmembranei883 – 903HelicalSequence analysisAdd BLAST21
Topological domaini904 – 923CytoplasmicSequence analysisAdd BLAST20
Transmembranei924 – 946HelicalSequence analysisAdd BLAST23
Topological domaini947 – 964ExtracellularSequence analysisAdd BLAST18
Transmembranei965 – 986HelicalSequence analysisAdd BLAST22
Topological domaini987 – 1005CytoplasmicSequence analysisAdd BLAST19
Transmembranei1006 – 1027HelicalSequence analysisAdd BLAST22
Topological domaini1028 – 1037ExtracellularSequence analysis10
Transmembranei1038 – 1059HelicalSequence analysisAdd BLAST22
Topological domaini1060 – 1220CytoplasmicSequence analysisAdd BLAST161

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
490

Open Targets

More...
OpenTargetsi
ENSG00000070961

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25107

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATP2B1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
14286104

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000462092 – 1220Plasma membrane calcium-transporting ATPase 1Add BLAST1219

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylglycineCombined sources1
Modified residuei8PhosphoserineCombined sources1
Modified residuei17PhosphoserineCombined sources1
Modified residuei338PhosphoserineBy similarity1
Modified residuei1116Phosphothreonine; by PKC1 Publication1
Modified residuei1140PhosphoserineBy similarity1
Modified residuei1155PhosphoserineCombined sources1
Modified residuei1165PhosphothreonineCombined sources1
Modified residuei1178Phosphoserine; by PKACombined sources1
Modified residuei1182PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P20020

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P20020

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P20020

PeptideAtlas

More...
PeptideAtlasi
P20020

PRoteomics IDEntifications database

More...
PRIDEi
P20020

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53706
53707 [P20020-2]
53708 [P20020-3]
53709 [P20020-4]
53710 [P20020-5]
53711 [P20020-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P20020

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P20020

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P20020

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform B: Ubiquitously expressed. Isoform C: Found in brain cortex, skeletal muscle and heart muscle. Isoform D: Has only been found in fetal skeletal muscle. Isoform K: Found in small intestine and liver.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000070961 Expressed in 234 organ(s), highest expression level in putamen

CleanEx database of gene expression profiles

More...
CleanExi
HS_ATP2B1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P20020 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P20020 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB005605
HPA011166
HPA012945

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PDZD11. Interacts with SLC35G1 and STIM1.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SCRIBQ141602EBI-5279998,EBI-357345

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106980, 47 interactors

Protein interaction database and analysis system

More...
IntActi
P20020, 33 interactors

Molecular INTeraction database

More...
MINTi
P20020

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000261173

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P20020

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P20020

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1100 – 1117Calmodulin-binding subdomain A1 PublicationAdd BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi296 – 299Poly-Glu4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoforms A, C, D and E contain and additional calmodulin-binding subdomain B which is different in the different splice variants and shows pH dependent calmodulin binding properties.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0204 Eukaryota
ENOG410XNNC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158686

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG061286

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P20020

KEGG Orthology (KO)

More...
KOi
K05850

Identification of Orthologs from Complete Genome Data

More...
OMAi
HYKKIPE

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P20020

TreeFam database of animal gene trees

More...
TreeFami
TF300330

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1110.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030320 ATP2B1
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase

The PANTHER Classification System

More...
PANTHERi
PTHR24093:SF245 PTHR24093:SF245, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12424 ATP_Ca_trans_C, 1 hit
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00831 Cation_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: P20020-3) [UniParc]FASTAAdd to basket
Also known as: CI, hPMCA1b1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDMANNSVA YSGVKNSLKE ANHDGDFGIT LAELRALMEL RSTDALRKIQ
60 70 80 90 100
ESYGDVYGIC TKLKTSPNEG LSGNPADLER REAVFGKNFI PPKKPKTFLQ
110 120 130 140 150
LVWEALQDVT LIILEIAAIV SLGLSFYQPP EGDNALCGEV SVGEEEGEGE
160 170 180 190 200
TGWIEGAAIL LSVVCVVLVT AFNDWSKEKQ FRGLQSRIEQ EQKFTVIRGG
210 220 230 240 250
QVIQIPVADI TVGDIAQVKY GDLLPADGIL IQGNDLKIDE SSLTGESDHV
260 270 280 290 300
KKSLDKDPLL LSGTHVMEGS GRMVVTAVGV NSQTGIIFTL LGAGGEEEEK
310 320 330 340 350
KDEKKKEKKN KKQDGAIENR NKAKAQDGAA MEMQPLKSEE GGDGDEKDKK
360 370 380 390 400
KANLPKKEKS VLQGKLTKLA VQIGKAGLLM SAITVIILVL YFVIDTFWVQ
410 420 430 440 450
KRPWLAECTP IYIQYFVKFF IIGVTVLVVA VPEGLPLAVT ISLAYSVKKM
460 470 480 490 500
MKDNNLVRHL DACETMGNAT AICSDKTGTL TMNRMTVVQA YINEKHYKKV
510 520 530 540 550
PEPEAIPPNI LSYLVTGISV NCAYTSKILP PEKEGGLPRH VGNKTECALL
560 570 580 590 600
GLLLDLKRDY QDVRNEIPEE ALYKVYTFNS VRKSMSTVLK NSDGSYRIFS
610 620 630 640 650
KGASEIILKK CFKILSANGE AKVFRPRDRD DIVKTVIEPM ASEGLRTICL
660 670 680 690 700
AFRDFPAGEP EPEWDNENDI VTGLTCIAVV GIEDPVRPEV PDAIKKCQRA
710 720 730 740 750
GITVRMVTGD NINTARAIAT KCGILHPGED FLCLEGKDFN RRIRNEKGEI
760 770 780 790 800
EQERIDKIWP KLRVLARSSP TDKHTLVKGI IDSTVSDQRQ VVAVTGDGTN
810 820 830 840 850
DGPALKKADV GFAMGIAGTD VAKEASDIIL TDDNFTSIVK AVMWGRNVYD
860 870 880 890 900
SISKFLQFQL TVNVVAVIVA FTGACITQDS PLKAVQMLWV NLIMDTLASL
910 920 930 940 950
ALATEPPTES LLLRKPYGRN KPLISRTMMK NILGHAFYQL VVVFTLLFAG
960 970 980 990 1000
EKFFDIDSGR NAPLHAPPSE HYTIVFNTFV LMQLFNEINA RKIHGERNVF
1010 1020 1030 1040 1050
EGIFNNAIFC TIVLGTFVVQ IIIVQFGGKP FSCSELSIEQ WLWSIFLGMG
1060 1070 1080 1090 1100
TLLWGQLIST IPTSRLKFLK EAGHGTQKEE IPEEELAEDV EEIDHAEREL
1110 1120 1130 1140 1150
RRGQILWFRG LNRIQTQIRV VNAFRSSLYE GLEKPESRSS IHNFMTHPEF
1160 1170 1180 1190 1200
RIEDSEPHIP LIDDTDAEDD APTKRNSSPP PSPNKNNNAV DSGIHLTIEM
1210 1220
NKSATSSSPG SPLHSLETSL
Length:1,220
Mass (Da):134,685
Last modified:September 12, 2018 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7E75C19B1A501423
GO
Isoform D (identifier: P20020-1) [UniParc]FASTAAdd to basket
Also known as: CIV, hPMCA1d1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1117: Q → QMDVVNAFQSGSSIQGALRRQPSIASQHHDVTNISTPTH

Show »
Length:1,258
Mass (Da):138,755
Checksum:i7037112747FC9B0A
GO
Isoform A (identifier: P20020-2) [UniParc]FASTAAdd to basket
Also known as: CII, hPMCA1a1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1118-1119: IR → MD
     1125-1220: RSSLYEGLEK...SPLHSLETSL → QSGSSIQGAL...VGYSSGECIS

Show »
Length:1,176
Mass (Da):129,516
Checksum:i5672202C16491703
GO
Isoform C (identifier: P20020-4) [UniParc]FASTAAdd to basket
Also known as: CIII, hPMCA1c1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1117: Q → QMDVVNAFQSGSSIQGALRRQPSIASQHHD

Show »
Length:1,249
Mass (Da):137,804
Checksum:i8F56F132BE096587
GO
Isoform E (identifier: P20020-5) [UniParc]FASTAAdd to basket
Also known as: CV

The sequence of this isoform differs from the canonical sequence as follows:
     1118-1119: IR → MD
     1125-1220: RSSLYEGLEK...SPLHSLETSL → QSGSSIQGAL...TASTTVGFEW

Show »
Length:1,171
Mass (Da):129,152
Checksum:i9FC9B1AA3B32B384
GO
Isoform K (identifier: P20020-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1021-1056: Missing.

Show »
Length:1,184
Mass (Da):130,617
Checksum:iB1FB3E7116D2FDA2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ERY9E7ERY9_HUMAN
Calcium-transporting ATPase
ATP2B1
963Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHH6H0YHH6_HUMAN
Plasma membrane calcium-transportin...
ATP2B1
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQU3A0A0U1RQU3_HUMAN
Plasma membrane calcium-transportin...
ATP2B1
300Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1V5F8W1V5_HUMAN
Plasma membrane calcium-transportin...
ATP2B1
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti259 – 262LLLS → MSAT in AAA36000 (PubMed:8386431).Curated4

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_000698267M → R Rare polymorphism. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0597711021 – 1056Missing in isoform K. Add BLAST36
Alternative sequenceiVSP_0597721117Q → QMDVVNAFQSGSSIQGALRR QPSIASQHHD in isoform C. 1
Alternative sequenceiVSP_0597731117Q → QMDVVNAFQSGSSIQGALRR QPSIASQHHDVTNISTPTH in isoform D. 1
Alternative sequenceiVSP_0597741118 – 1119IR → MD in isoform A and isoform E. 2
Alternative sequenceiVSP_0597751125 – 1220RSSLY…LETSL → QSGSSIQGALRRQPSIASQH HDVTNISTPTHVVFSSSTAS TTVGYSSGECIS in isoform A. Add BLAST96
Alternative sequenceiVSP_0597761125 – 1220RSSLY…LETSL → QSGSSIQGALRRQPSIASQH HDVTNISTPTHVVFSSSTAS TTVGFEW in isoform E. Add BLAST96

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
J04027 mRNA Translation: AAA74511.1
M95541 mRNA Translation: AAA35999.1
M95542 mRNA Translation: AAA36000.1
L14561 Genomic DNA Translation: AAD09924.1
L14561 Genomic DNA Translation: AAD09925.1
M25824 Genomic DNA Translation: AAA58383.1
M25824 Genomic DNA Translation: AAA58382.1
M25824 Genomic DNA Translation: AAA58381.1
S49852 mRNA Translation: AAB24324.1
U15686 mRNA Translation: AAA60983.1
U15687 mRNA Translation: AAA60984.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41817.1 [P20020-2]
CCDS9035.1 [P20020-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A30802
E49570
I55491
I70165

NCBI Reference Sequences

More...
RefSeqi
NP_001001323.1, NM_001001323.1 [P20020-2]
NP_001673.2, NM_001682.2 [P20020-3]
XP_011536709.1, XM_011538407.2 [P20020-4]
XP_016874847.1, XM_017019358.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.506276

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261173; ENSP00000261173; ENSG00000070961 [P20020-3]
ENST00000359142; ENSP00000352054; ENSG00000070961 [P20020-2]
ENST00000428670; ENSP00000392043; ENSG00000070961 [P20020-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
490

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:490

UCSC genome browser

More...
UCSCi
uc001tbg.4 human [P20020-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04027 mRNA Translation: AAA74511.1
M95541 mRNA Translation: AAA35999.1
M95542 mRNA Translation: AAA36000.1
L14561 Genomic DNA Translation: AAD09924.1
L14561 Genomic DNA Translation: AAD09925.1
M25824 Genomic DNA Translation: AAA58383.1
M25824 Genomic DNA Translation: AAA58382.1
M25824 Genomic DNA Translation: AAA58381.1
S49852 mRNA Translation: AAB24324.1
U15686 mRNA Translation: AAA60983.1
U15687 mRNA Translation: AAA60984.1
CCDSiCCDS41817.1 [P20020-2]
CCDS9035.1 [P20020-3]
PIRiA30802
E49570
I55491
I70165
RefSeqiNP_001001323.1, NM_001001323.1 [P20020-2]
NP_001673.2, NM_001682.2 [P20020-3]
XP_011536709.1, XM_011538407.2 [P20020-4]
XP_016874847.1, XM_017019358.1
UniGeneiHs.506276

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6A69electron microscopy4.11A1-1220[»]
ProteinModelPortaliP20020
SMRiP20020
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106980, 47 interactors
IntActiP20020, 33 interactors
MINTiP20020
STRINGi9606.ENSP00000261173

Protein family/group databases

TCDBi3.A.3.2.25 the p-type atpase (p-atpase) superfamily

PTM databases

iPTMnetiP20020
PhosphoSitePlusiP20020
SwissPalmiP20020

Polymorphism and mutation databases

BioMutaiATP2B1
DMDMi14286104

Proteomic databases

EPDiP20020
MaxQBiP20020
PaxDbiP20020
PeptideAtlasiP20020
PRIDEiP20020
ProteomicsDBi53706
53707 [P20020-2]
53708 [P20020-3]
53709 [P20020-4]
53710 [P20020-5]
53711 [P20020-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261173; ENSP00000261173; ENSG00000070961 [P20020-3]
ENST00000359142; ENSP00000352054; ENSG00000070961 [P20020-2]
ENST00000428670; ENSP00000392043; ENSG00000070961 [P20020-3]
GeneIDi490
KEGGihsa:490
UCSCiuc001tbg.4 human [P20020-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
490
DisGeNETi490
EuPathDBiHostDB:ENSG00000070961.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATP2B1
HGNCiHGNC:814 ATP2B1
HPAiCAB005605
HPA011166
HPA012945
MIMi108731 gene
neXtProtiNX_P20020
OpenTargetsiENSG00000070961
PharmGKBiPA25107

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0204 Eukaryota
ENOG410XNNC LUCA
GeneTreeiENSGT00940000158686
HOVERGENiHBG061286
InParanoidiP20020
KOiK05850
OMAiHYKKIPE
PhylomeDBiP20020
TreeFamiTF300330

Enzyme and pathway databases

BRENDAi3.6.3.8 2681
ReactomeiR-HSA-418359 Reduction of cytosolic Ca++ levels
R-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATP2B1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ATP2B1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
490

Protein Ontology

More...
PROi
PR:P20020

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000070961 Expressed in 234 organ(s), highest expression level in putamen
CleanExiHS_ATP2B1
ExpressionAtlasiP20020 baseline and differential
GenevisibleiP20020 HS

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR030320 ATP2B1
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase
PANTHERiPTHR24093:SF245 PTHR24093:SF245, 1 hit
PfamiView protein in Pfam
PF12424 ATP_Ca_trans_C, 1 hit
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT2B1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P20020
Secondary accession number(s): Q12992
, Q12993, Q13819, Q13820, Q13821, Q16504, Q93082
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: September 12, 2018
Last modified: December 5, 2018
This is version 207 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again