Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P19544 (WT1_HUMAN)

Protein

Wilms tumor protein

Gene

WT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that plays an important role in cellular development and cell survival (PubMed:7862533). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3' (PubMed:7862533, PubMed:17716689, PubMed:25258363). Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital system. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors (PubMed:15520190). Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing (PubMed:16934801). Isoform 1 has lower affinity for DNA, and can bind RNA (PubMed:19123921).7 Publications

Miscellaneous

Presence of the KTS motif hinders interactions between DNA and zinc-finger 4.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei424Important for interaction with target DNA1
Sitei430Important for interaction with target DNA1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri323 – 347C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri353 – 377C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri383 – 405C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri414 – 438C2H2-type 4PROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, RNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P19544

SIGNOR Signaling Network Open Resource

More...SIGNORi		P19544

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Wilms tumor protein
Alternative name(s):
WT33
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000184937.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:12796 WT1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607102 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P19544

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Frasier syndrome (FS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionCharacterized by a slowly progressing nephropathy leading to renal failure in adolescence or early adulthood, male pseudohermaphroditism, and no Wilms tumor. As for histological findings of the kidneys, focal glomerular sclerosis is often observed. There is phenotypic overlap with Denys-Drash syndrome. Inheritance is autosomal dominant.
See also OMIM:136680
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_015060392F → L in FS. 1 Publication1
Wilms tumor 1 (WT1)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionEmbryonal malignancy of the kidney that affects approximately 1 in 10'000 infants and young children. It occurs both in sporadic and hereditary forms.
See also OMIM:194070
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_007739181P → S in WT1. 2 PublicationsCorresponds to variant dbSNP:rs2234584Ensembl.1
Natural variantiVAR_007740223S → N in WT1. 1 Publication1
Natural variantiVAR_007741253G → A in WT1. 1 Publication1
Natural variantiVAR_043799355C → G in WT1. 1 Publication1
Natural variantiVAR_007745366R → C in WT1, DDS and MEACHS. 4 Publications1
Natural variantiVAR_007746366R → H in DDS and WT1. 4 Publications1
Natural variantiVAR_007747373H → Q in DDS and WT1. 1 Publication1
Natural variantiVAR_043807394R → L in WT1. 1 Publication1
Denys-Drash syndrome (DDS)17 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionTypical nephropathy characterized by diffuse mesangial sclerosis, genital abnormalities, and/or Wilms tumor. There is phenotypic overlap with WAGR syndrome and Frasier syndrome. Inheritance is autosomal dominant, but most cases are sporadic.
See also OMIM:194080
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_007743330C → Y in DDS. 1 Publication1
Natural variantiVAR_015054342M → R in DDS. 1 Publication1
Natural variantiVAR_015055355C → Y in DDS. 2 Publications1
Natural variantiVAR_007744360C → G in DDS. 1
Natural variantiVAR_043800360C → Y in DDS. 1 Publication1
Natural variantiVAR_007746366R → H in DDS and WT1. 4 Publications1
Natural variantiVAR_043802366R → L in DDS. 1 Publication1
Natural variantiVAR_043803369Q → P in DDS. 1 Publication1
Natural variantiVAR_007747373H → Q in DDS and WT1. 1 Publication1
Natural variantiVAR_015056373H → Y in DDS. 1 Publication1
Natural variantiVAR_015057377H → R in DDS. 1 Publication1
Natural variantiVAR_015058385C → R in DDS. 3 Publications1
Natural variantiVAR_015059388C → F in DDS. 1 Publication1
Natural variantiVAR_043806388C → Y in DDS. 1 Publication1
Natural variantiVAR_043808394R → P in DDS. 1 Publication1
Natural variantiVAR_015061394R → Q in DDS and NPHS4. 3 Publications1
Natural variantiVAR_007750394R → W in DDS, WT1, MEACHS and NPHS4. 9 Publications1
Natural variantiVAR_007752396D → G in DDS. 1
Natural variantiVAR_007751396D → N in DDS and NPHS4. 3 Publications1
Natural variantiVAR_043809396D → Y in DDS. 1 Publication1
Natural variantiVAR_015062398L → P in DDS. 2 Publications1
Natural variantiVAR_043811401H → Y in DDS. 1 Publication1
Natural variantiVAR_043812405H → R in DDS. 1 Publication1
Nephrotic syndrome 4 (NPHS4)5 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of nephrotic syndrome, a renal disease clinically characterized by severe proteinuria, resulting in complications such as hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. Most patients with NPHS4 show diffuse mesangial sclerosis on renal biopsy, which is a pathologic entity characterized by mesangial matrix expansion with no mesangial hypercellularity, hypertrophy of the podocytes, vacuolized podocytes, thickened basement membranes, and diminished patency of the capillary lumen.
See also OMIM:256370
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_015053312R → Q in NPHS4. 1 Publication1
Natural variantiVAR_043801364F → L in NPHS4. 1 Publication1
Natural variantiVAR_007748377H → Y in NPHS4. 1 Publication1
Natural variantiVAR_043804379G → C in NPHS4. 1 Publication1
Natural variantiVAR_007749383F → L in NPHS4. 1 Publication1
Natural variantiVAR_043805388C → R in NPHS4. 2 Publications1
Natural variantiVAR_015061394R → Q in DDS and NPHS4. 3 Publications1
Natural variantiVAR_007750394R → W in DDS, WT1, MEACHS and NPHS4. 9 Publications1
Natural variantiVAR_007751396D → N in DDS and NPHS4. 3 Publications1
Natural variantiVAR_043810397H → P in NPHS4. 2 Publications1
Meacham syndrome (MEACHS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionRare sporadically occurring multiple malformation syndrome characterized by male pseudohermaphroditism with abnormal internal female genitalia comprising a uterus and double or septate vagina, complex congenital heart defect and diaphragmatic abnormalities.
See also OMIM:608978
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_007745366R → C in WT1, DDS and MEACHS. 4 Publications1
A chromosomal aberration involving WT1 may be a cause of desmoplastic small round cell tumor (DSRCT). Translocation t(11;22)(p13;q12) with EWSR1.
Mesothelioma, malignant (MESOM)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionAn aggressive neoplasm of the serosal lining of the chest. It appears as broad sheets of cells, with some regions containing spindle-shaped, sarcoma-like cells and other regions showing adenomatous patterns. Pleural mesotheliomas have been linked to exposure to asbestos.
See also OMIM:156240

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi73K → R: Abolishes sumoylation; when associated with R-177. 1 Publication1
Mutagenesisi177K → R: Abolishes sumoylation; when associated with R-77. 1 Publication1
Mutagenesisi343H → A: Reduced RNA binding. 1 Publication1
Mutagenesisi366R → A: Strongly reduced binding of DNA and RNA. 1 Publication1
Mutagenesisi372R → A: Strongly reduced binding of DNA and RNA. 1 Publication1
Mutagenesisi394R → A or S: Strongly reduced binding of DNA and RNA. 1 Publication1
Mutagenesisi434H → A: Reduced RNA binding. 1 Publication1

Keywords - Diseasei

Disease mutation, Tumor suppressor

Organism-specific databases

DisGeNET

More...DisGeNETi		7490

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		WT1

MalaCards human disease database

More...MalaCardsi		WT1
MIMi136680 phenotype
156240 phenotype
194070 phenotype
194080 phenotype
256370 phenotype
608978 phenotype

Open Targets

More...OpenTargetsi		ENSG00000184937

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		242 46,XY complete gonadal dysgenesis
251510 46,XY partial gonadal dysgenesis
220 Denys-Drash syndrome
83469 Desmoplastic small round cell tumor
93217 Familial idiopathic steroid-resistant nephrotic syndrome with diffuse mesangial sclerosis
93213 Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis
347 Frasier syndrome
3097 Meacham syndrome
654 Nephroblastoma
93220 Sporadic idiopathic steroid-resistant nephrotic syndrome with diffuse mesangial sclerosis
893 WAGR syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37395

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		WT1

Domain mapping of disease mutations (DMDM)

More...DMDMi		139778

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000471311 – 449Wilms tumor proteinAdd BLAST449

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki73Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication
Cross-linki177Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication
Cross-linki444Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		P19544

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P19544

PeptideAtlas

More...PeptideAtlasi		P19544

PRoteomics IDEntifications database

More...PRIDEi		P19544

ProteomicsDB human proteome resource

More...ProteomicsDBi		53673
53674 [P19544-2]
53675 [P19544-3]
53676 [P19544-4]
53677 [P19544-6]
53678 [P19544-7]
53679 [P19544-8]
53680 [P19544-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P19544

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P19544

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the kidney and a subset of hematopoietic cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000184937 Expressed in 116 organ(s), highest expression level in germinal epithelium of ovary

CleanEx database of gene expression profiles

More...CleanExi		HS_WT1

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P19544 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P19544 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB000327
HPA035717
HPA053848

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with WTIP. Interacts with actively translating polysomes. Detected in nuclear ribonucleoprotein (mRNP) particles. Interacts with HNRNPU via the zinc-finger region. Interacts with U2AF2. Interacts with CITED2 (By similarity). Interacts with ZNF224 via the zinc-finger region. Interacts with WTAP and SRY. Interacts with AMER1. Interacts with RBM4.By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		113327, 55 interactors

Protein interaction database and analysis system

More...IntActi		P19544, 24 interactors

Molecular INTeraction database

More...MINTi		P19544

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000331327

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1449
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LU6model-A310-449[»]
1XF7NMR-A381-407[»]
2G7Tmodel-A310-449[»]
2G7Vmodel-A310-449[»]
2G7Wmodel-A310-449[»]
2G7Xmodel-A310-449[»]
2JP9NMR-A318-438[»]
2JPANMR-A318-438[»]
2PRTX-ray3.15A318-438[»]
3HPJX-ray2.00C/F126-134[»]
3MYJX-ray1.89C/F126-134[»]
4R2EX-ray1.84A350-440[»]
4R2PX-ray1.79A350-440[»]
4R2QX-ray1.54A350-440[»]
4R2RX-ray2.09A350-440[»]
4R2SX-ray2.49A350-440[»]
4WUUX-ray3.05C126-134[»]
5KL2X-ray1.69A350-440[»]
5KL3X-ray1.45A350-440[»]
5KL4X-ray1.78A/D350-440[»]
5KL5X-ray2.29A350-440[»]
5KL6X-ray1.64A350-440[»]
5KL7X-ray1.58A350-440[»]
6B0OX-ray1.55A/D321-440[»]
6B0PX-ray2.08A/D321-440[»]
6B0QX-ray2.79A/D321-440[»]
6B0RX-ray1.82A/D321-440[»]
6BLWX-ray1.83A319-440[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P19544

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P19544

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P19544

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni367 – 381Important for interaction with target DNAAdd BLAST15
Regioni393 – 401Important for interaction with target DNA9

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi408 – 410KTS motif3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi27 – 83Pro-richAdd BLAST57

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binds to DNA motifs with the sequence 5'-GCG(T/G)GGGCG-3' via its C2H2-type zinc fingers. Starting from the N-terminus, the second zinc finger binds to the 3'-GCG motif, the middle zinc finger interacts with the central TGG motif, and the C-terminal zinc finger binds to the 5'-GCG motif. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Has reduced affinity for target DNA where the cytosines have been oxidized to 5-hydroxymethylcytosine, 5-formylcytosine or 5-carboxylcytosine.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the EGR C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri323 – 347C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri353 – 377C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri383 – 405C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri414 – 438C2H2-type 4PROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156734

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG006960

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P19544

KEGG Orthology (KO)

More...KOi		K09234

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P19544

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR017987 Wilms_tumour
IPR000976 Wilms_tumour_N
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

The PANTHER Classification System

More...PANTHERi		PTHR44601 PTHR44601, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02165 WT1, 1 hit
PF00096 zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00355 ZnF_C2H2, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667 SSF57667, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 8 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P19544-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSDVRDLNA LLPAVPSLGG GGGCALPVSG AAQWAPVLDF APPGASAYGS 
        60         70         80         90        100
LGGPAPPPAP PPPPPPPPHS FIKQEPSWGG AEPHEEQCLS AFTVHFSGQF 
       110        120        130        140        150
TGTAGACRYG PFGPPPPSQA SSGQARMFPN APYLPSCLES QPAIRNQGYS 
       160        170        180        190        200
TVTFDGTPSY GHTPSHHAAQ FPNHSFKHED PMGQQGSLGE QQYSVPPPVY 
       210        220        230        240        250
GCHTPTDSCT GSQALLLRTP YSSDNLYQMT SQLECMTWNQ MNLGATLKGV 
       260        270        280        290        300
AAGSSSSVKW TEGQSNHSTG YESDNHTTPI LCGAQYRIHT HGVFRGIQDV 
       310        320        330        340        350
RRVPGVAPTL VRSASETSEK RPFMCAYPGC NKRYFKLSHL QMHSRKHTGE 
       360        370        380        390        400
KPYQCDFKDC ERRFSRSDQL KRHQRRHTGV KPFQCKTCQR KFSRSDHLKT 
       410        420        430        440 
HTRTHTGKTS EKPFSCRWPS CQKKFARSDE LVRHHNMHQR NMTKLQLAL
Note: Detected in nucleus speckle, may bind mRNA.
Length:449
Mass (Da):49,188
Last modified:August 1, 1991 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i11C7FA3D485096B2
GO
Isoform 2 (identifier: P19544-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     250-266: Missing.
     408-410: Missing.

Show »
Length:429
Mass (Da):47,195
Checksum:iC2F9912E0A4DA3DB
GO
Isoform 3 (identifier: P19544-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     250-266: Missing.

Show »
Length:432
Mass (Da):47,511
Checksum:i1ACA6CE3563DA9D2
GO
Isoform 4 (identifier: P19544-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     408-410: Missing.

Show »
Length:446
Mass (Da):48,872
Checksum:i8CE7FC116A41DA04
GO
Isoform 6 (identifier: P19544-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-144: Missing.
     145-147: RNQ → MEK
     408-410: Missing.

Show »
Length:302
Mass (Da):34,447
Checksum:i715B121077C0991D
GO
Isoform 7 (identifier: P19544-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDFLLLQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGASGSEPQQM

Note: Produced by alternative initiation of isoform 1. Extended N-terminus.
Show »
Length:522
Mass (Da):56,883
Checksum:iFB30F6E34A60EC04
GO
Isoform 8 (identifier: P19544-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDFLLLQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGASGSEPQQM
     250-266: Missing.

Note: Produced by alternative initiation of isoform 1. Extended N-terminus.
Show »
Length:505
Mass (Da):55,206
Checksum:iC7CE98CE8B83C250
GO
Isoform 9 (identifier: P19544-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-144: Missing.
     145-147: RNQ → MEK
     250-266: Missing.

Note: No experimental confirmation available.
Show »
Length:288
Mass (Da):33,086
Checksum:i9526D02081619728
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KNN9J3KNN9_HUMAN
Wilms tumor protein
WT1
517Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7K5H0Y7K5_HUMAN
Wilms tumor protein
WT1
514Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT54A0A0A0MT54_HUMAN
Wilms tumor protein
WT1
497Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YED9H0YED9_HUMAN
Wilms tumor protein
WT1
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PQQ0A0A1W2PQQ0_HUMAN
Wilms tumor protein
WT1
497Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PPP2A0A1W2PPP2_HUMAN
Wilms tumor protein
WT1
514Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PR07A0A1W2PR07_HUMAN
Wilms tumor protein
WT1
517Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y3F0H0Y3F0_HUMAN
Wilms tumor protein
WT1
317Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKS2E9PKS2_HUMAN
Wilms tumor protein
WT1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPW3E9PPW3_HUMAN
Wilms tumor protein
WT1
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB33443 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence CAA35956 differs from that shown. Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.Curated
The sequence CAA35956 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAC39220 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAI95758 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAI95759 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti288I → M in AAH32861 (PubMed:15489334).Curated1
Sequence conflicti365S → F in AAA36810 (PubMed:2154335).Curated1
Sequence conflicti365S → F in AAB33443 (PubMed:7862533).Curated1
Sequence conflicti387T → A in CAA43819 (PubMed:1572653).Curated1

<p>This subsection of the ‘Sequence’ section provides information relevant to all types of RNA editing events (conversion, insertion, deletion of nucleotides) that lead to one or more amino acid changes compared to the translation of the non-edited RNA version.<p><a href='/help/rna_editing' target='_top'>More...</a></p>RNA editingi

Edited at position 281.1 Publication
Partially edited.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043798131A → T in a patient with hypospadias. 1 Publication1
Natural variantiVAR_007739181P → S in WT1. 2 PublicationsCorresponds to variant dbSNP:rs2234584Ensembl.1
Natural variantiVAR_007740223S → N in WT1. 1 Publication1
Natural variantiVAR_007741253G → A in WT1. 1 Publication1
Natural variantiVAR_007742273S → G Found in a mesothelioma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs121907908Ensembl.1
Natural variantiVAR_058021281L → P in RNA edited version. 1
Natural variantiVAR_015053312R → Q in NPHS4. 1 Publication1
Natural variantiVAR_007743330C → Y in DDS. 1 Publication1
Natural variantiVAR_015054342M → R in DDS. 1 Publication1
Natural variantiVAR_043799355C → G in WT1. 1 Publication1
Natural variantiVAR_015055355C → Y in DDS. 2 Publications1
Natural variantiVAR_007744360C → G in DDS. 1
Natural variantiVAR_043800360C → Y in DDS. 1 Publication1
Natural variantiVAR_043801364F → L in NPHS4. 1 Publication1
Natural variantiVAR_007745366R → C in WT1, DDS and MEACHS. 4 Publications1
Natural variantiVAR_007746366R → H in DDS and WT1. 4 Publications1
Natural variantiVAR_043802366R → L in DDS. 1 Publication1
Natural variantiVAR_043803369Q → P in DDS. 1 Publication1
Natural variantiVAR_007747373H → Q in DDS and WT1. 1 Publication1
Natural variantiVAR_015056373H → Y in DDS. 1 Publication1
Natural variantiVAR_015057377H → R in DDS. 1 Publication1
Natural variantiVAR_007748377H → Y in NPHS4. 1 Publication1
Natural variantiVAR_043804379G → C in NPHS4. 1 Publication1
Natural variantiVAR_007749383F → L in NPHS4. 1 Publication1
Natural variantiVAR_015058385C → R in DDS. 3 Publications1
Natural variantiVAR_015059388C → F in DDS. 1 Publication1
Natural variantiVAR_043805388C → R in NPHS4. 2 Publications1
Natural variantiVAR_043806388C → Y in DDS. 1 Publication1
Natural variantiVAR_015060392F → L in FS. 1 Publication1
Natural variantiVAR_043807394R → L in WT1. 1 Publication1
Natural variantiVAR_043808394R → P in DDS. 1 Publication1
Natural variantiVAR_015061394R → Q in DDS and NPHS4. 3 Publications1
Natural variantiVAR_007750394R → W in DDS, WT1, MEACHS and NPHS4. 9 Publications1
Natural variantiVAR_007752396D → G in DDS. 1
Natural variantiVAR_007751396D → N in DDS and NPHS4. 3 Publications1
Natural variantiVAR_043809396D → Y in DDS. 1 Publication1
Natural variantiVAR_043810397H → P in NPHS4. 2 Publications1
Natural variantiVAR_015062398L → P in DDS. 2 Publications1
Natural variantiVAR_043811401H → Y in DDS. 1 Publication1
Natural variantiVAR_043812405H → R in DDS. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0375821 – 144Missing in isoform 6 and isoform 9. 2 PublicationsAdd BLAST144
Alternative sequenceiVSP_0375831M → MDFLLLQDPASTCVPEPASQ HTLRSGPGCLQQPEQQGVRD PGGIWAKLGAAEASAERLQG RRSRGASGSEPQQM in isoform 7 and isoform 8. 1 Publication1
Alternative sequenceiVSP_037584145 – 147RNQ → MEK in isoform 6 and isoform 9. 2 Publications3
Alternative sequenceiVSP_006866250 – 266Missing in isoform 2, isoform 3, isoform 8 and isoform 9. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_006867408 – 410Missing in isoform 2, isoform 4 and isoform 6. 3 Publications3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X51630 mRNA Translation: CAA35956.1 Sequence problems.
M80232
, M80217, M80218, M80219, M80220, M80221, M80228, M80229, M80231 Genomic DNA Translation: AAA61299.1
X61631
, X61632, X61633, X61634, X61635, X61636, X61637, X61638 Genomic DNA Translation: CAA43819.1
AK093168 mRNA Translation: BAG52667.1
AK291736 mRNA Translation: BAF84425.1
AY245105 Genomic DNA Translation: AAO61088.1
AL049692 Genomic DNA Translation: CAC39220.3 Different initiation.
AL049692 Genomic DNA Translation: CAI95758.2 Different initiation.
AL049692 Genomic DNA Translation: CAI95759.2 Different initiation.
AL049692 Genomic DNA Translation: CAI95760.1
CH471064 Genomic DNA Translation: EAW68220.1
CH471064 Genomic DNA Translation: EAW68223.1
CH471064 Genomic DNA Translation: EAW68224.1
BC032861 mRNA Translation: AAH32861.1
M30393 mRNA Translation: AAA36810.1
S75264 mRNA Translation: AAB33443.1 Sequence problems.
S61515 Genomic DNA Translation: AAB20110.1
S61522 Genomic DNA Translation: AAB20111.1
S61524 Genomic DNA Translation: AAB20112.1
S60755 Genomic DNA Translation: AAC60605.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55750.1 [P19544-9]
CCDS55751.1 [P19544-6]
CCDS7878.2 [P19544-7]

Protein sequence database of the Protein Information Resource

More...PIRi		A38080

NCBI Reference Sequences

More...RefSeqi		NP_000369.3, NM_000378.4
NP_001185480.1, NM_001198551.1 [P19544-6]
NP_001185481.1, NM_001198552.1 [P19544-9]
NP_077742.2, NM_024424.3
NP_077744.3, NM_024426.4 [P19544-7]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.591980

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000379079; ENSP00000368370; ENSG00000184937 [P19544-6]
ENST00000530998; ENSP00000435307; ENSG00000184937 [P19544-9]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7490

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7490

UCSC genome browser

More...UCSCi		uc001mtl.3 human [P19544-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Chromosomal rearrangement, RNA editing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X51630 mRNA Translation: CAA35956.1 Sequence problems.
M80232
, M80217, M80218, M80219, M80220, M80221, M80228, M80229, M80231 Genomic DNA Translation: AAA61299.1
X61631
, X61632, X61633, X61634, X61635, X61636, X61637, X61638 Genomic DNA Translation: CAA43819.1
AK093168 mRNA Translation: BAG52667.1
AK291736 mRNA Translation: BAF84425.1
AY245105 Genomic DNA Translation: AAO61088.1
AL049692 Genomic DNA Translation: CAC39220.3 Different initiation.
AL049692 Genomic DNA Translation: CAI95758.2 Different initiation.
AL049692 Genomic DNA Translation: CAI95759.2 Different initiation.
AL049692 Genomic DNA Translation: CAI95760.1
CH471064 Genomic DNA Translation: EAW68220.1
CH471064 Genomic DNA Translation: EAW68223.1
CH471064 Genomic DNA Translation: EAW68224.1
BC032861 mRNA Translation: AAH32861.1
M30393 mRNA Translation: AAA36810.1
S75264 mRNA Translation: AAB33443.1 Sequence problems.
S61515 Genomic DNA Translation: AAB20110.1
S61522 Genomic DNA Translation: AAB20111.1
S61524 Genomic DNA Translation: AAB20112.1
S60755 Genomic DNA Translation: AAC60605.1
CCDSiCCDS55750.1 [P19544-9]
CCDS55751.1 [P19544-6]
CCDS7878.2 [P19544-7]
PIRiA38080
RefSeqiNP_000369.3, NM_000378.4
NP_001185480.1, NM_001198551.1 [P19544-6]
NP_001185481.1, NM_001198552.1 [P19544-9]
NP_077742.2, NM_024424.3
NP_077744.3, NM_024426.4 [P19544-7]
UniGeneiHs.591980

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LU6model-A310-449[»]
1XF7NMR-A381-407[»]
2G7Tmodel-A310-449[»]
2G7Vmodel-A310-449[»]
2G7Wmodel-A310-449[»]
2G7Xmodel-A310-449[»]
2JP9NMR-A318-438[»]
2JPANMR-A318-438[»]
2PRTX-ray3.15A318-438[»]
3HPJX-ray2.00C/F126-134[»]
3MYJX-ray1.89C/F126-134[»]
4R2EX-ray1.84A350-440[»]
4R2PX-ray1.79A350-440[»]
4R2QX-ray1.54A350-440[»]
4R2RX-ray2.09A350-440[»]
4R2SX-ray2.49A350-440[»]
4WUUX-ray3.05C126-134[»]
5KL2X-ray1.69A350-440[»]
5KL3X-ray1.45A350-440[»]
5KL4X-ray1.78A/D350-440[»]
5KL5X-ray2.29A350-440[»]
5KL6X-ray1.64A350-440[»]
5KL7X-ray1.58A350-440[»]
6B0OX-ray1.55A/D321-440[»]
6B0PX-ray2.08A/D321-440[»]
6B0QX-ray2.79A/D321-440[»]
6B0RX-ray1.82A/D321-440[»]
6BLWX-ray1.83A319-440[»]
ProteinModelPortaliP19544
SMRiP19544
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113327, 55 interactors
IntActiP19544, 24 interactors
MINTiP19544
STRINGi9606.ENSP00000331327

PTM databases

iPTMnetiP19544
PhosphoSitePlusiP19544

Polymorphism and mutation databases

BioMutaiWT1
DMDMi139778

Proteomic databases

MaxQBiP19544
PaxDbiP19544
PeptideAtlasiP19544
PRIDEiP19544
ProteomicsDBi53673
53674 [P19544-2]
53675 [P19544-3]
53676 [P19544-4]
53677 [P19544-6]
53678 [P19544-7]
53679 [P19544-8]
53680 [P19544-9]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		7490
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379079; ENSP00000368370; ENSG00000184937 [P19544-6]
ENST00000530998; ENSP00000435307; ENSG00000184937 [P19544-9]
GeneIDi7490
KEGGihsa:7490
UCSCiuc001mtl.3 human [P19544-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7490
DisGeNETi7490
EuPathDBiHostDB:ENSG00000184937.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		WT1
GeneReviewsiWT1

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0009531
HGNCiHGNC:12796 WT1
HPAiCAB000327
HPA035717
HPA053848
MalaCardsiWT1
MIMi136680 phenotype
156240 phenotype
194070 phenotype
194080 phenotype
256370 phenotype
607102 gene
608978 phenotype
neXtProtiNX_P19544
OpenTargetsiENSG00000184937
Orphaneti242 46,XY complete gonadal dysgenesis
251510 46,XY partial gonadal dysgenesis
220 Denys-Drash syndrome
83469 Desmoplastic small round cell tumor
93217 Familial idiopathic steroid-resistant nephrotic syndrome with diffuse mesangial sclerosis
93213 Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis
347 Frasier syndrome
3097 Meacham syndrome
654 Nephroblastoma
93220 Sporadic idiopathic steroid-resistant nephrotic syndrome with diffuse mesangial sclerosis
893 WAGR syndrome
PharmGKBiPA37395

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000156734
HOVERGENiHBG006960
InParanoidiP19544
KOiK09234
OrthoDBi1318335at2759
PhylomeDBiP19544

Enzyme and pathway databases

SignaLinkiP19544
SIGNORiP19544

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		WT1 human
EvolutionaryTraceiP19544

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		WT1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7490

Protein Ontology

More...PROi		PR:P19544

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000184937 Expressed in 116 organ(s), highest expression level in germinal epithelium of ovary
CleanExiHS_WT1
ExpressionAtlasiP19544 baseline and differential
GenevisibleiP19544 HS

Family and domain databases

InterProiView protein in InterPro
IPR017987 Wilms_tumour
IPR000976 Wilms_tumour_N
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PANTHERiPTHR44601 PTHR44601, 1 hit
PfamiView protein in Pfam
PF02165 WT1, 1 hit
PF00096 zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 4 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWT1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P19544
Secondary accession number(s): A8K6S1
, B3KSA5, Q15881, Q16256, Q16575, Q4VXV4, Q4VXV5, Q4VXV6, Q8IYZ5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: August 1, 1991
Last modified: January 16, 2019
This is version 229 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again